PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g006150.2.1
Common NameLOC101251954
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 308aa    MW: 35707.1 Da    PI: 9.0182
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g006150.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.69.2e-3160113255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtpeLH +Fv+a+++LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Solyc03g006150.2.1  60 PRLRWTPELHLSFVSAIDRLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 113
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.97956116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2856114IPR009057Homeodomain-like
SuperFamilySSF466893.76E-1459114IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2260115IPR006447Myb domain, plants
PfamPF002491.8E-861112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MTSDSIDLNE EVGDQEGIEV VISDESHEKI IDENNNNNST SCGDYENNKR VRQYVRSKLP  60
RLRWTPELHL SFVSAIDRLG GQERATPKLV LQMMNVRGLS IAHVKSHLQM YRSKKLGEFG  120
QVLGHAYRTN NQGRSYLYGK LSQRLFNPLQ DFKMKNGAIV LARNFNDDDN HFQNSFAKTP  180
YETKEKFPRY LENHEICPVR QRHFHEEKRW PPCEFNQNKL NSQSLFHQNG PKWNCTYNSL  240
GPKFKTPFRF EMKQDKMFIK EKDYLLPDLQ LGLSTTNQDN NNSKEKNSSD INTMLSLSLP  300
SYSSSAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1961115458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g006150.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234092.10.0uncharacterized protein LOC101251954
TrEMBLK4BE380.0K4BE38_SOLLC; Uncharacterized protein
STRINGSolyc03g006150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.12e-36G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]