PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g092570.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 439aa    MW: 49434.5 Da    PI: 5.6069
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g092570.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.41.7e-94554352373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPil 91 
                         ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL  r a+   +++k l+++ +++++ ++ ++  l  f++++P++
  Solyc02g092570.1.1  55 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTCGFLRALILRAAK--IGTCKLLTANLNHSMEtHKFSIIELASFVDLTPWH 143
                         79****************************************************..666666666655544436666666677******** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefn 179
                         +f++ +aN  Ileaveg + +Hi+Df++++++Q p+L++a ++R egpp +++T+ g+ e        ++ee+g +L +fA++ +v +ef+
  Solyc02g092570.1.1 144 RFGFTAANASILEAVEGYSIIHIVDFSLTHCMQIPTLIDAVSTRVEGPPLIKLTVAGATEDLppmLDLSYEELGAKLVNFARSRNVMMEFR 234
                         **********************************************************776698888999********************* PP

                GRAS 180 vl.......vakrledleleeLrvkp......gEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnsesFler 256
                         v+            +++ +e+Lrv++      gEal++n++++lh++++e++ +++  r  +Lk++++l P++vv+v+++ad +s++++ r
  Solyc02g092570.1.1 235 VIpssssdgF----SNV-IEQLRVQNlirpdnGEALVINCHMMLHYIPEETTVISNsFRAMFLKAIRNLDPTIVVLVDEDADFTSNNLVCR 320
                         *977643333....333.66666665555677*****************99998886899******************************* PP

                GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                         + +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r er e +++W +r+++a F++  +se+ ++++k +l +++  
  Solyc02g092570.1.1 321 LRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAQEGIQRLERLEPKSQWVQRMRNANFRSSGFSEEGVTEVKNMLDEHA-A 409
                         ********************************.********************************************************.9 PP

                GRAS 348 gyrveeesgslvlgWkdrpLvsvSaW 373
                         g+ ++ +++ lvl+Wk++++v+++aW
  Solyc02g092570.1.1 410 GWGLKRDEEYLVLTWKGHNVVFATAW 435
                         99************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.45728417IPR005202Transcription factor GRAS
PfamPF035145.9E-9255435IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MQFTESLPPQ VSSFSSLMMN KDSSTNNNQI QRARPWPGFH TSKNLGNIGD TNCMEQLLVH  60
CANAIESNDA TLAQQILWVL NNIAPPDGDS NQRLTCGFLR ALILRAAKIG TCKLLTANLN  120
HSMETHKFSI IELASFVDLT PWHRFGFTAA NASILEAVEG YSIIHIVDFS LTHCMQIPTL  180
IDAVSTRVEG PPLIKLTVAG ATEDLPPMLD LSYEELGAKL VNFARSRNVM MEFRVIPSSS  240
SDGFSNVIEQ LRVQNLIRPD NGEALVINCH MMLHYIPEET TVISNSFRAM FLKAIRNLDP  300
TIVVLVDEDA DFTSNNLVCR LRSAFNYLWI PYDTVDTFLP RGSKQRQWYE ADICWKIENV  360
IAQEGIQRLE RLEPKSQWVQ RMRNANFRSS GFSEEGVTEV KNMLDEHAAG WGLKRDEEYL  420
VLTWKGHNVV FATAWVPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B3e-485543734420Protein SHORT-ROOT
5b3h_E3e-485543734420Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g092570.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265160.0Solanum lycopersicum chromosome 2 clone C02SLe0053H21, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004231909.10.0scarecrow-like protein 32
SwissprotQ9SN221e-180SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A3Q7FB540.0A0A3Q7FB54_SOLLC; Uncharacterized protein
STRINGSolyc02g092570.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87812429
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]