PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g092070.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 569aa    MW: 61367.4 Da    PI: 8.3139
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g092070.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.81e-24209252144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e
  Solyc02g092070.2.1 209 DPEPGRCRRTDGKKWRCSREAVPDQKYCERHINRGRHRSRKHVE 252
                         79****************************************98 PP

2QLQ61.71.9e-21139175137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+++L++Q+l+yK+++an PvP++Ll +i+k
  Solyc02g092070.2.1 139 GPFTPSQWMELEHQALIYKHFVANIPVPHHLLIPIKK 175
                         59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.9E-13139175IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.511140175IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.7E-15140173IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.563209253IPR014977WRC domain
PfamPF088798.7E-21210252IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MDFGGLMTME TAQQSETSNG SGQLKQQRSD DNIWRPSKVP KPADDLSAYC KQQGPTSTLF  60
MRSDSPNDGR GHSTMLSFSS NKSEEIPFLS TNNVSAQDSS TNLPFPLFDS GSYNTRAASA  120
YASGGSNENT PGSFSRFRGP FTPSQWMELE HQALIYKHFV ANIPVPHHLL IPIKKSVNPY  180
AFSGLSAVPY ASSNWGWGTF HLGFAGNTDP EPGRCRRTDG KKWRCSREAV PDQKYCERHI  240
NRGRHRSRKH VEVQNGHAVS GSTTSKVASV APSSSATVIS SSGTLLNSGG ASNSLGTVQQ  300
QLNSLQPSAA NPNTEQLVNR MLGHRGASVI SPTICVKPKD SAISVQKQHN GVELSSLTDF  360
GLVSSDSLLN PSQRNSFVNP KNPIAFLNFN DQERSEQHPV HHFIDGWAKE QSSRASTCWP  420
DQLKDWTQLS MSIPMTASDF ASSSSSPRQE KLTLSPLRVS CNVDPIQMGL GMTSSCGEPM  480
QKTASWVPVC WEHSLGGPLG EVLNSTAGVL QKTTFVSLSN SSSGSSPRGD SKKVHDGIGM  540
CDEVIGLTVA SSVCIPSMEV SCLIKNKH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g092070.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316034.10.0growth-regulating factor 2-like isoform X2
TrEMBLA0A3Q7FYY80.0A0A3Q7FYY8_SOLLC; Uncharacterized protein
STRINGSolyc02g092070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16882357
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.15e-91growth-regulating factor 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]