PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g090400.2.1
Common NameLOC101255362
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 372aa    MW: 41678.2 Da    PI: 8.7557
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g090400.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32237292156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGG+++AtPk+i+++m+v+gLt+++vkSHLQkYRl+
  Solyc02g090400.2.1 237 KQRRCWSPELHRRFVDALHQLGGPQVATPKQIRDIMQVDGLTNDEVKSHLQKYRLH 292
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.863234294IPR017930Myb domain
SuperFamilySSF466892.33E-17235295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-29235295IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-26237292IPR006447Myb domain, plants
PfamPF002499.1E-8239290IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGSNSKEMNI DLNFVYVPKL ISDVLTEVSA MDDISKKLKK LNQFLVPLEE ELTKIEAFKR  60
ELPLCMLLLK HAIERLKAEA LLYKEKDKSP VMMEEFIPLK KGNSDEIGRV KKSNDLSDKK  120
NWMSSAQLWS TPVQYESFNL QNLKRSGVED KAKEKQYQLG ACKLTSERGA FLPFQRQALK  180
VDKKCLAVKD LSLSMAVTVG EGENRENPID VSVKRENGPS NSNGCDGFSH DKSLQRKQRR  240
CWSPELHRRF VDALHQLGGP QVATPKQIRD IMQVDGLTND EVKSHLQKYR LHVRRVPASG  300
CSWSTVDENG ESSKNNGTQS GSPEGPLHFT GSGSAKGVSV NEEEDNKSES YNWNGQLHKS  360
IEGSTIRSSS H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13237290154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13237290154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13237290154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13237290154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-13237290255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.104490.0callus| flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g090400.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265170.0Solanum lycopersicum chromosome 2 clone C02SLe0056J19, complete sequence
GenBankAC2327740.0Solanum lycopersicum chromosome 2 clone C02SLe0056J10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233639.10.0transcription factor HHO5-like
TrEMBLA0A3Q7FAA10.0A0A3Q7FAA1_SOLLC; Uncharacterized protein
STRINGSolyc02g090400.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-60G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]