PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g090310.1.1
Common NameLOC101253547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 261aa    MW: 28593.9 Da    PI: 8.625
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g090310.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-3946104361
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +++l+cprCds ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+ 
  Solyc02g090310.1.1  46 SENLRCPRCDSPNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKSI 104
                         57899***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.6E-3348103IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2549102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39449103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MIQELFAGNT TLIGDDNISN ITPSSSPISC TTSNSNIAPA SANANSENLR CPRCDSPNTK  60
FCYYNNYNLT QPRHFCKTCR RYWTKGGALR NVPIGGGCRK NKSIATSKST AAKFKNSLPF  120
EFIGKSGIFG GFEQEIIPSN YDNNNPFLFS SPHQNHNPIL SLLKGNLHKS IGVNQFPSNN  180
GIWKNNYEEN VGEVQNSRGF QELYQRLKAS TNRCYTDNMH GPSSSSMILD SAPVTGGELG  240
CWNPTLSTWL DLPTANGAYL *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.140240.0flower| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g090310.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265170.0Solanum lycopersicum chromosome 2 clone C02SLe0056J19, complete sequence
GenBankAC2327740.0Solanum lycopersicum chromosome 2 clone C02SLe0056J10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232062.10.0dof zinc finger protein DOF1.7
TrEMBLA0A3Q7FC590.0A0A3Q7FC59_SOLLC; Uncharacterized protein
STRINGSolyc02g090310.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-34DOF zinc finger protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]