PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g089520.1.1
Common NameLOC101245415
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 410aa    MW: 45676.6 Da    PI: 4.8871
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g089520.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.42.5e-071960439
            zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        r+C+ + +   +++C+ ++ +lC+dC   +H        H++
  Solyc02g089520.1.1 19 RVCDSCRSVTCTIYCQADSAYLCADCDARIHAAslvtsrHKR 60
                        79******99*********************65777777775 PP

2zf-B_box284.7e-0960104240
            zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40 
                         + ++C+ +e+ ++ + C+ +   lC++C   +H+       H ++
  Solyc02g089520.1.1  60 RVWVCEACERAPAAFLCKADAASLCASCDADIHSAnplahrHHRI 104
                         5689****************************9668888554444 PP

3CCT69.77.3e-24340383144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Solyc02g089520.1.1 340 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 383
                         9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.7981663IPR000315B-box-type zinc finger
SMARTSM003361.6E-61863IPR000315B-box-type zinc finger
CDDcd000218.81E-91963No hitNo description
PROSITE profilePS5011910.87959106IPR000315B-box-type zinc finger
PfamPF006435.4E-760106IPR000315B-box-type zinc finger
CDDcd000216.78E-862106No hitNo description
SMARTSM003365.2E-764106IPR000315B-box-type zinc finger
PROSITE profilePS5101716.638340382IPR010402CCT domain
PfamPF062039.4E-18340382IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MLKKENSGGL DGSSNYWARV CDSCRSVTCT IYCQADSAYL CADCDARIHA ASLVTSRHKR  60
VWVCEACERA PAAFLCKADA ASLCASCDAD IHSANPLAHR HHRIPIITIP GTLYGPPAVE  120
TVGGDSMMIS GSTGEGTEDD GFLSLTQDAD DTIIDEEDED EDEAASWLLL NHPVKNNNKN  180
NVNNNNNQTN NYDMLFGGEV VDDYLDLAEY GGDSQFNDQY NVNQQQQQYF VPQMSYGGDS  240
VVPVQDGQGK PLIFYQQQQQ QQQSHHQNFQ LGMEYDNSNT RLGYPASMSH SVSVVSMDVS  300
VVPESALCET SNSQPRPQKG TIELFSGHPI QIPLLTPMDR EARVLRYREK KKNRKFEKTI  360
RYASRKAYAE TRPRIKGRFA KRTDVEAEVD QMFSTQLMTD SSYRIVPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.169620.0callus| fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed throughout development.
UniprotTISSUE SPECIFICITY: Highly expressed in leaves. Expressed at lower levels in stems, flowers and siliques. Not detected in roots.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g089520.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4902530.0Lycopersicon esculentum CONSTANS 3 (CO3) gene, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001316711.10.0CONSTANS 3
SwissprotQ965021e-115COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLA0A3Q7FBQ10.0A0A3Q7FBQ1_SOLLC; Uncharacterized protein
STRINGSolyc02g089520.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52482337
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15840.12e-75B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]