PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g089420.1.1
Common NameLOC101260992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 181aa    MW: 21052.5 Da    PI: 6.3486
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g089420.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.5e-1481139563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L ++l++ ++  +++ +e+
  Solyc02g089420.1.1  81 RKQRRMISNRESARRSRMRKQRHLDELWAQVLWLRNENHQLLDKLNHASERHDQVLQEN 139
                         689********************************************999999888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-1477141IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.51979142IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-1281130No hitNo description
Gene3DG3DSA:1.20.5.1704.1E-1181153No hitNo description
PfamPF001702.6E-1281139IPR004827Basic-leucine zipper domain
CDDcd147027.68E-2082133No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MQPTDVTDFY YLLPSNPTQF PSQSCVNYNP STFQLNTVLN PLYHLQITPQ VQDLNPQLTC  60
FNSNSTSDEA DEQQWTLINE RKQRRMISNR ESARRSRMRK QRHLDELWAQ VLWLRNENHQ  120
LLDKLNHASE RHDQVLQENA QLKNETSELR KMITGMQLSS PCPSSRALEN EPCSGLPQNE  180
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193100RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g089420.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316197.11e-131basic leucine zipper 43
RefseqXP_015064470.11e-131basic leucine zipper 43
TrEMBLA0A3Q7FXF71e-129A0A3Q7FXF7_SOLLC; Uncharacterized protein
STRINGSolyc02g089420.1.11e-130(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Representative plantOGRP31041129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.19e-51basic leucine-zipper 42
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]