PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g088070.2.1
Common NameLOC101252243
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 463aa    MW: 51224.9 Da    PI: 6.3908
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g088070.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-38106165261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +ek+l+cprC+s++tkfCy+nny+ sqPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  Solyc02g088070.2.1 106 PEKTLPCPRCNSMETKFCYFNNYNASQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKHKNS 165
                         78999***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-27103163IPR003851Zinc finger, Dof-type
PfamPF027012.5E-31108164IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.379110164IPR003851Zinc finger, Dof-type
PROSITE patternPS013610112148IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MSEAIAIKDP AIKLFGWTIQ LPDFPAPAPE DSSFLAGEVE QELKGLYDDC IDDNEHLTTE  60
DSQDQNPIQQ RCDIINYYES STAKTSKSKE EHGETSNSHE RNLKKPEKTL PCPRCNSMET  120
KFCYFNNYNA SQPRHFCKNC QRYWTAGGTM RNVPVGAGRR KHKNSVLHYS HVSVSEALSN  180
VRTNFPTETQ HPPLTLNGTI LSFDTDKPVS ESMVSVLNVA DKGMQNCSGN GFQKYKELRI  240
QAGDNGDDHS DGSSVTAISS KDSDNGLPNT PRKNYNSFPT HLPCFTGAPW PYIWSSVHCR  300
NAVPPPGYSL PGIPMSFIPA TTYWGCTIPG SWNVPWMSPP TASHNQMPLT PDPNSPTSRK  360
HSRDENVLKS TGTEEEQRKE SDPGKRLWFP KTLRIDDPGE AAKSPIWATL GIKHEVVNSV  420
GGGLLSDFLP KNDERSCVSE NSTLLQVNPA AMSRSLNFNE SS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g088070.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327690.0Solanum lycopersicum chromosome 2 clone C02HBa0054K23, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232217.10.0cyclic dof factor 3-like
RefseqXP_025885361.10.0cyclic dof factor 3-like
TrEMBLA0A3Q7FWP30.0A0A3Q7FWP3_SOLLC; Uncharacterized protein
STRINGSolyc02g088070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-82cycling DOF factor 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]