PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g086690.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 95aa    MW: 11091.7 Da    PI: 9.1831
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g086690.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.8e-181562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT eEd++l+++++ +G g W++ ar  g++Rt+k+c++rw++yl
  Solyc02g086690.2.1 15 KGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYL 62
                        79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-24865IPR009057Homeodomain-like
PROSITE profilePS5129421.9211066IPR017930Myb domain
SMARTSM007171.0E-121464IPR001005SANT/Myb domain
PfamPF002496.0E-171562IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-221690IPR009057Homeodomain-like
CDDcd001673.45E-101762No hitNo description
Gene3DG3DSA:1.10.10.605.1E-86689IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MDKRTCDSQD VEVRKGPWTM EEDLILINYI ANHGEGVWNS LARSAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITPEEQLLIM ELHAKWGNRI FYPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-14128924100MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First detected in 15-20 mm buds. Expression increases as flowers develop. {ECO:0000269|PubMed:1840903}.
UniprotTISSUE SPECIFICITY: Expressed only in flowers. {ECO:0000269|PubMed:1840903}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g086690.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153534e-72Solanum lycopersicum chromosome 2 clone C02HBa0011A02, complete sequence
GenBankAC2154654e-72Solanum lycopersicum chromosome 2 clone C02SLe0123B22, complete sequence
GenBankAC2158534e-72Solanum lycopersicum chromosome 2 clone C02HBa0031A13, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338574.13e-61PREDICTED: myb-related protein 340-like
SwissprotP813912e-59MYB05_ANTMA; Myb-related protein 305
TrEMBLM0ZI776e-60M0ZI77_SOLTU; Uncharacterized protein
STRINGSolyc02g086690.2.15e-65(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.11e-54myb domain protein 24
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C
    Expression patterns of myb genes from Antirrhinum flowers.
    Plant Cell, 1991. 3(2): p. 115-25
    [PMID:1840903]