PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g085160.1.1
Common NameLOC101261565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 294aa    MW: 33312.9 Da    PI: 8.1131
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g085160.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.41.5e-3290145460
         ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         vrYkeClkNhAa+lGg+++DGCgEfmps gee t + lkCaAC+CHRnFHR+e+e+e
  Solyc02g085160.1.1  90 VRYKECLKNHAANLGGYVLDGCGEFMPS-GEEETLEYLKCAACDCHRNFHRKETEDE 145
                         89*************************9.8888********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2190143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.1E-3090142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-2991141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.20692141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.7E-29224291IPR009057Homeodomain-like
SuperFamilySSF466891.32E-18225290IPR009057Homeodomain-like
TIGRFAMsTIGR015653.3E-26229286IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEHRGQEKDM GLPNPNPMSY NPSQLNQQES SSSAANKFLT APNRTTNEHE NTIFSPNQTL  60
DQHNITQNSD PDPVRQLSTS SASERNITPV RYKECLKNHA ANLGGYVLDG CGEFMPSGEE  120
ETLEYLKCAA CDCHRNFHRK ETEDESQTPG VHRNNHRIPN QTPPSLPAVP TQQQHHHKYP  180
HSYPRGHMAP VMMSFGGNTG VAAESSSEDL NMFHGGQGVI QPCNFSASKK RFRTKFSQQQ  240
KDRMLEFAEK LGWRIQKQDE QEVHQFCNEV GVKRQVFKVW MHNSKQATKK KQN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-222282851673ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.102590.0flower| fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, stems, flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g085160.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153630.0Solanum lycopersicum chromosome 2 clone C02HBa0030A21, complete sequence
GenBankAC2153780.0Solanum lycopersicum chromosome 2 clone C02HBa0074A14, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232414.10.0zinc-finger homeodomain protein 6
SwissprotQ9ZPW71e-66ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A3Q7F7J50.0A0A3Q7F7J5_SOLLC; Uncharacterized protein
STRINGSolyc02g085160.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.15e-69homeobox protein 24
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]