PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g084420.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family DBB
Protein Properties Length: 89aa    MW: 9572.16 Da    PI: 5.5724
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g084420.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.11.8e-08433534
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeH 34
                         C+ +e+  ++lfC  ++  lC+ C ++ H
  Solyc02g084420.2.1  4 LCDVCESAAAILFCAADEAALCRACDEKVH 33
                        7**************************999 PP

2zf-B_box28.72.8e-095284234
            zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeH 34
                        e ++C+ +e+ ++ ++Ce +++ lC +C +  H
  Solyc02g084420.2.1 52 EVPRCDICENSPAFFYCEVDGSSLCLQCDMMVH 84
                        789**************************9888 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-8147IPR000315B-box-type zinc finger
PROSITE profilePS5011910.139147IPR000315B-box-type zinc finger
CDDcd000213.40E-5345No hitNo description
PfamPF006437.4E-7342IPR000315B-box-type zinc finger
SuperFamilySSF578456.64E-54885No hitNo description
PROSITE profilePS501199.1295188IPR000315B-box-type zinc finger
SMARTSM003362.9E-45188IPR000315B-box-type zinc finger
PfamPF006431.1E-75184IPR000315B-box-type zinc finger
CDDcd000211.70E-55484No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MRTLCDVCES AAAILFCAAD EAALCRACDE KVHMCNKLAS RHVRVGIAKP NEVPRCDICE  60
NSPAFFYCEV DGSSLCLQCD MMVHVGGK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.12191e-148fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327768e-49Solanum lycopersicum chromosome 2 clone C02SLm0132H19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015066178.12e-59PREDICTED: B-box zinc finger protein 19-like
SwissprotC0SVM52e-51BBX19_ARATH; B-box zinc finger protein 19
TrEMBLK4BAV85e-59K4BAV8_SOLLC; Uncharacterized protein
TrEMBLM0ZW206e-58M0ZW20_SOLTU; Uncharacterized protein
STRINGSolyc02g084420.2.12e-58(Solanum lycopersicum)
STRINGPGSC0003DMT4000093282e-57(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31752340
Representative plantOGRP33521628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38960.11e-52DBB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]