PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g084350.2.1
Common NameLOC101253645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 350aa    MW: 40127.6 Da    PI: 4.7648
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g084350.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.22.3e-5581371129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL+ k    ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+
  Solyc02g084350.2.1   8 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLQdKcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGR 97 
                         69****************************.9***************943432233667******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+v++ k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  Solyc02g084350.2.1  98 DKAVYN-KSKLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 137
                         ******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-605157IPR003441NAC domain
PROSITE profilePS5100559.5858157IPR003441NAC domain
PfamPF023651.1E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDTNESCVPP GFRFHPTDEE LVGYYLRKKI ASQKIDLDVI RDIDLYRIEP WDLQDKCRIG  60
YEEQNEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKA VYNKSKLIGM RKTLVFYKGR  120
APNGQKSDWI MHEYRLESEE NGPPQEEGWV VCRAFKKKIT GQTKSNNMVE GWESNYFYDE  180
ATTATISSIV DPLEYITRQP PNLSNNNFNN LLCKQETSMD QAAENNLNFS YTNSDQFIQL  240
PQLESPSLPL LKRPISSMSL VSDNNNNNNN NNHDEDGSKN VTADWRALDK FVASQLSHEE  300
TTLYEDDQHN CSDLGMLLLL SDRGEGPKLN EILSSSSEDS DIGICLFDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-51816217170NO APICAL MERISTEM PROTEIN
1ut4_B8e-51816217170NO APICAL MERISTEM PROTEIN
1ut7_A8e-51816217170NO APICAL MERISTEM PROTEIN
1ut7_B8e-51816217170NO APICAL MERISTEM PROTEIN
3swm_A9e-51816220173NAC domain-containing protein 19
3swm_B9e-51816220173NAC domain-containing protein 19
3swm_C9e-51816220173NAC domain-containing protein 19
3swm_D9e-51816220173NAC domain-containing protein 19
3swp_A9e-51816220173NAC domain-containing protein 19
3swp_B9e-51816220173NAC domain-containing protein 19
3swp_C9e-51816220173NAC domain-containing protein 19
3swp_D9e-51816220173NAC domain-containing protein 19
4dul_A8e-51816217170NAC domain-containing protein 19
4dul_B8e-51816217170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root metaxylem pole and in shoot pre-procambium and procambium (PubMed:18445131). Present in root developing xylems (PubMed:16103214). Specifically expressed in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g084350.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2327760.0Solanum lycopersicum chromosome 2 clone C02SLm0132H19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316409.10.0NAC domain-containing protein 37-like
SwissprotQ9SL411e-157NAC37_ARATH; NAC domain-containing protein 37
TrEMBLM0ZVN60.0M0ZVN6_SOLTU; Uncharacterized protein
STRINGSolyc02g084350.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-138vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  4. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]