PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g082670.2.1
Common NameLOC101258516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 275aa    MW: 30745.4 Da    PI: 5.6102
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g082670.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.39.5e-2294154257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+ Fe+ n +p++++++e++++l    +++e++V++WFqNrRa+ k+
  Solyc02g082670.2.1  94 RQRWTPTPMQLQILERIFEQgNGTPTKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 154
                         89*****************99**************************************97 PP

2Wus_type_Homeobox101.75.2e-3394156365
   Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         r+RWtPtp Q++iLe+++++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Solyc02g082670.2.1  94 RQRWTPTPMQLQILERIFEQGNGTPTKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 156
                         89***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.32190155IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-1890160IPR009057Homeodomain-like
SMARTSM003893.1E-1592159IPR001356Homeobox domain
SuperFamilySSF466892.4E-1992159IPR009057Homeodomain-like
CDDcd000861.20E-1594156No hitNo description
PfamPF000461.8E-1994154IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDWEKQQQQP PVSAPQQTAE ELNGTVSGGM FVKVMTDEQM EVLRKQIAVY ATICEQLVDL  60
HKSMASQHDL AGARLGNLYC DPLVTSAGHK ITGRQRWTPT PMQLQILERI FEQGNGTPTK  120
QKIKEITSEL SQHGQISETN VYNWFQNRRA RSKRKQQVAA TNNTESEVET EVESPNEKKT  180
KPEDLQSSHM PTSMAEDLGY ENPDVSSGMH SLDPRTSKPE PMFPSDGSSK PAASYGQMSF  240
YGMSNPRMDQ LMGKMEVPGS YHPYIHADDY NMTG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147155RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.192500.0flower| fruit| leaf| root| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g082670.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154500.0Solanum lycopersicum chromosome 2 clone C02SLe0026H18, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001335376.10.0WUSCHEL-related homeobox 8
RefseqXP_015064959.10.0WUSCHEL-related homeobox 8
SwissprotQ5QMM31e-87WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A3Q7F8C30.0A0A3Q7F8C3_SOLLC; Uncharacterized protein
STRINGSolyc02g082670.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56752437
Representative plantOGRP18731639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-79WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]