PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g082380.1.1
Common NameLOC104645780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 223aa    MW: 25013.6 Da    PI: 10.2078
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g082380.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-1258102347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+ E+ l++ + +++G g+Wk+I+r+    +t+ q+ s+ qky
  Solyc02g082380.1.1  58 PWTEGEHSLFLMGLNKFGRGDWKSISRHYVVSKTPTQVASHAQKY 102
                         7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.44651107IPR017930Myb domain
SuperFamilySSF466893.43E-1553107IPR009057Homeodomain-like
SMARTSM007178.6E-755105IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.0E-1656105IPR006447Myb domain, plants
CDDcd001678.34E-958103No hitNo description
PfamPF002497.2E-1058102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-858102IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEEMKNLYIN LFKEAEMENP SINTNVVDNS SDKEANPNDT PPPPVQITHS RPHRRGIPWT  60
EGEHSLFLMG LNKFGRGDWK SISRHYVVSK TPTQVASHAQ KYFCRRNSKT PVDRRRPSIN  120
DIQTVTVNST RTTTTTASNN NDQVGSLSRP FRYANYTFGG PTFANNSNGN FGIYHPGEAS  180
GSNSFIMKQN NNNNNNDLHR PVSPRPFHSM YLSSTKGNNP QV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g082380.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154520.0Solanum lycopersicum chromosome 2 clone C02SLe0033D19, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316490.11e-164transcription factor MYB1R1-like
TrEMBLK4BAA91e-142K4BAA9_SOLLC; Uncharacterized protein
STRINGSolyc02g082380.1.11e-164(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52342032
Representative plantOGRP1230136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-29MYB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]