PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g081640.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 706aa    MW: 78524.4 Da    PI: 4.4844
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g081640.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.36.4e-12558599346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rW++++ el+++av+q+G++  ++I + ++ gRt+ q+k+++ k
  Solyc02g081640.2.1 558 RWSKQDTELFYEAVQQFGTD-LSLIQQLFP-GRTRRQLKLKYKK 599
                         9*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159632.7E-28549633No hitNo description
PROSITE profilePS5129310.79554605IPR017884SANT domain
SMARTSM007171.9E-9555603IPR001005SANT/Myb domain
SuperFamilySSF466892.84E-10557606IPR009057Homeodomain-like
CDDcd001671.22E-7558599No hitNo description
Gene3DG3DSA:1.10.10.601.0E-6558599IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MIFLLEVLQR LAGGKFQPKA KPRPVKKGPA VASSSLTSKP TGDTVATDYS EGFKSAKNSQ  60
NCDEQSPVLA EPSLGRPLAA ETLVPSVGSS LDASMVITDN NEDWKSCFEK SEGENADIYI  120
GLDSFDDLLP HSSGIDPSAA HAAGAEKRQE QLLVPVSSVD GSAHSASNLQ SDEVAAGQDP  180
LTFQASVLSV SGSCQMETDT YSFLEADILG VTTISGQSRR FQPKPKLQVY RERYDTIIPD  240
LDVGESVPCL PDSQSVHSEM DFVNSEKGHG LPAADVLDFS VRGFDIITES AHDFPVHEDY  300
VVEASLPDAD IPENHSEATS QMPEESVPQR PKNKKQKFPA SELSAISEEN GESRLLRSRR  360
KSVNASRLVD ESDEDVIGDG EYVPEHPNDS VTIGNDEEFL VENDSQGKKV QKKSKKTVTK  420
EGKRVRKSKK TAEASDQAAN KKPKKFSHST RQKRRTVDKA LLEAPMDEID YSKVPIKDLI  480
LLAEHRERLA KKDAAVSQMP PTTTDQSAGA SVSNYDEDET YASDEDGEAD DHNKSTMGED  540
TSSYFNYQTY MDKTPSTRWS KQDTELFYEA VQQFGTDLSL IQQLFPGRTR RQLKLKYKKE  600
ERQNPFRLHD VLTNRSKDHS HFERVIEHLK QIEAEELQYA DKDESIDLTG EEEMVGNQEI  660
CEEAKSEHVE EKEVETVEQD VPNPVKEYDD DEDDFMKWSQ YTSEV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1410429QKKSKKTVTKEGKRVRKSKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.162740.0callus| cell culture| flower| fruit| leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g081640.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153680.0Solanum lycopersicum chromosome 2 clone C02HBa0044O16, complete sequence
GenBankAC2153790.0Solanum lycopersicum chromosome 2 clone C02HBa0075D08, complete sequence
GenBankAC2154790.0Solanum lycopersicum chromosome 2 clone C02SLm0049G16, complete sequence
GenBankGU0488950.0Solanum lycopersicum clone BAC CaCM511O09-Tomato, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316529.10.0transcription factor TFIIIB component B'' isoform X3
TrEMBLM1BI380.0M1BI38_SOLTU; Uncharacterized protein
STRINGSolyc02g081640.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59022326
Representative plantOGRP8075913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.11e-49MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]