PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g080860.1.1
Common NameLOC101255761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 254aa    MW: 28345.9 Da    PI: 6.8886
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g080860.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.53e-334396255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWt++LH++Fv+ave+LGG+++AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Solyc02g080860.1.1 43 PRLRWTHDLHRCFVHAVERLGGEDRATPKMVLQLMDVKGLTISHVKSHLQMYRS 96
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.7553999IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-323998IPR009057Homeodomain-like
SuperFamilySSF466899.85E-164197IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-254397IPR006447Myb domain, plants
PfamPF002492.7E-74495IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MMNELHPFSD NSPSNLSMKQ PIMLENTNNN KSGVRPYVRS KMPRLRWTHD LHRCFVHAVE  60
RLGGEDRATP KMVLQLMDVK GLTISHVKSH LQMYRSMKHE QLMQAVAEAA NGSKSNKMDG  120
PDQVHYPHGN FLHHYYNGHP NSTITSTYSD HIASTPAFIP PAPWRPMPKK MMGLEGRLDP  180
ACNMFRDFFN GCTTVQDGSV GDQYGSSLSN KHFSIIDTEE EAEDSGSITM FAQPSAGLED  240
VNNNNISLDL TLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-184499358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-184499358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-184499358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-184499358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-184499459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g080860.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233787.10.0myb family transcription factor EFM-like isoform X1
TrEMBLA0A3Q7F7B81e-120A0A3Q7F7B8_SOLLC; Uncharacterized protein
STRINGSolyc02g080860.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74502029
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-34G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]