PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g080740.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 278aa    MW: 31985.5 Da    PI: 10.2615
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g080740.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.58.2e-304092254
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                        prlrWt++LH rFv +ve+LGG ++AtPk++l++m+vkgLt++h+kSHLQ+Y+
  Solyc02g080740.1.1 40 PRLRWTHDLHCRFVYVVERLGGVDRATPKRVLQIMDVKGLTISHIKSHLQMYK 92
                        8***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-283695IPR009057Homeodomain-like
SuperFamilySSF466896.63E-143993IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-224093IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MMKGLEFSEN SPSLSMELEY RSNDKSSEFA IRTYVKSTMP RLRWTHDLHC RFVYVVERLG  60
GVDRATPKRV LQIMDVKGLT ISHIKSHLQM YKNMKHQEMQ AEAANGKKRN RIDGSDSMNI  120
PQRNLVRRHN HIKGKAAMFD GSDRMNFPQR NLVHRYNHIK SKAAMFDGSD QMNFSQGNLV  180
HCYNHNNGKA PIFNGSDEMN FPQGNLVHRY NHNNGKSVFD GYLNPTVTTN YLDKIPSSST  240
AFPPPWFVSF FFSFFFLLKM GTILSVNTFY IINVVIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g080740.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154071e-167Solanum lycopersicum chromosome 2 clone C02HBa0167J21, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027770015.11e-143two-component response regulator ORR24-like
TrEMBLA0A3Q7F5V81e-171A0A3Q7F5V8_SOLLC; Uncharacterized protein
STRINGSolyc02g080740.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13843412
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.11e-26G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]