PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g080730.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 270aa    MW: 30691.4 Da    PI: 10.3417
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g080730.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-322578255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWt +LH+rFv+av++LGG ++AtPk +l++m+vkg+t++h+kSHLQ+YR+
  Solyc02g080730.1.1 25 PRLRWTDDLHRRFVHAVDHLGGVDRATPKMVLQIMNVKGVTISHIKSHLQMYRS 78
                        8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5182181IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-302279IPR009057Homeodomain-like
SuperFamilySSF466896.81E-162379IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-242578IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MELGNNNSDK SSEFFIRAYV KPKMPRLRWT DDLHRRFVHA VDHLGGVDRA TPKMVLQIMN  60
VKGVTISHIK SHLQMYRSLK HQEMQAEAAN GRKRNRIDAS DSMNNLWANL VHRYNHINGK  120
AAVIDGSDQM NFPQGNLVNG YNHIKGKAAM FDGSNQMNFP QGNLIHCYNH NNRKAPIFNG  180
SNQMNISQGN LVHCYNHNNG KAPIINGSNQ MNFPQGNLVQ RYNHNNGKSV FDGHLNPTVT  240
TNYLEKIASS STVFPPPWFV SFFFSSFFLX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-182682460Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g080730.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154070.0Solanum lycopersicum chromosome 2 clone C02HBa0167J21, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027770015.11e-135two-component response regulator ORR24-like
TrEMBLA0A3Q7F5V81e-137A0A3Q7F5V8_SOLLC; Uncharacterized protein
STRINGSolyc02g080730.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13843412
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.19e-28G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]