PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g080720.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 327aa    MW: 37378.4 Da    PI: 10.0987
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g080720.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.73e-294092254
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                        prlrWt+++H+rFv ave+ GG ++AtPk +l++m+vkgLt++h+kSHLQ+Y+
  Solyc02g080720.1.1 40 PRLRWTHDIHRRFVYAVERVGGVDRATPKMVLQIMDVKGLTISHIKSHLQMYK 92
                        8***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-273895IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-214093IPR006447Myb domain, plants
SuperFamilySSF466892.69E-134093IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MMKGLEFSKN SPSLSMELGY SSNYKSSKFA IRAYIKSIMP RLRWTHDIHR RFVYAVERVG  60
GVDRATPKMV LQIMDVKGLT ISHIKSHLQM YKNMKHQEMQ GEAANGRKRN RIDGSDSMNI  120
PQRNLVRRHN HIKGKTAMFD GSDSINFPQR NLVDRYNHIK SKAAMFDGSD QMNFPQGNLV  180
HCYNHNNGKA PIFKGSDQMN FTQRNLVHRY NYNNGKSVFD DHLNPTVTTN YLDKIASSST  240
AFPPPWKSMP EKKMGLERRY YLFRDFFDGT ITIRDGDNDD KIVRAYGISN LPNKSATSMV  300
EEEDSHSTIS LDLSLSSYIS LDLTLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-164196358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-164196358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-164196358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-164196358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-164197460Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g080720.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154071e-135Solanum lycopersicum chromosome 2 clone C02HBa0167J21, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027770015.10.0two-component response regulator ORR24-like
TrEMBLK4B9U30.0K4B9U3_SOLLC; Uncharacterized protein
STRINGSolyc02g080720.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13843412
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.16e-27G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]