PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g078810.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 485aa    MW: 54454.7 Da    PI: 10.8453
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g078810.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73e-09743138
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                        +++W t+E+++l  av+++G+++W+ +a+++   Rtl+
  Solyc02g078810.2.1  7 KMNWGTWEELILGSAVRRHGTRDWNVVASELR-ARTLY 43
                        689*****************************.99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-4741IPR009057Homeodomain-like
PfamPF002493.3E-7741IPR001005SANT/Myb domain
CDDcd001675.14E-4953No hitNo description
SMARTSM002972.8E-17253357IPR001487Bromodomain
CDDcd043691.55E-14256352No hitNo description
Gene3DG3DSA:1.20.920.105.0E-17256385IPR001487Bromodomain
SuperFamilySSF473702.62E-18258357IPR001487Bromodomain
PfamPF004391.5E-10262341IPR001487Bromodomain
PROSITE profilePS5001410.525268338IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MGVGVGKMNW GTWEELILGS AVRRHGTRDW NVVASELRAR TLYPHCFTPE ACKASALFEE  60
LRKRRVEELK RELVRSESSI GSLESKIERL QAERERSDQI DHGLSRTKSP APQTKSEDIE  120
SSVKEEAKDG LSAGSFTLDI RTNGSSESQV PTIPSATEAV VKLELSEFWG RDKAPSTSKV  180
PESANGNGGA VRKRRGKRRR KDTVWDAKEG SIEDSDNVCS TSLASTSHCK EVLTSCDQSN  240
RRSAASDHIV GLSRFRNDDL MRIFNSITQH EAAMVFRHRL DSQKRARYKK MIRRHMDIET  300
ARSRLANWSI RTPSELFRDF LLLANNAMVF YSKRTREYKA AMALRDIVTR AYREHYKGSY  360
HKATSSHLPL PIIGNPPGKP RSVRPRPSKE KLQAKYGNNI IAGTLGRQNH KPGDAADSKV  420
PSQTPSSAKK GFKRPGKIKC GSTTETVNPQ SKVQAKESSQ HNIKVKKEHR VKAVTKERKR  480
ARQK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193201RRGKRRRKD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.228450.0fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g078810.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153800.0Solanum lycopersicum chromosome 2 clone C02HBa0090O01, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232825.10.0uncharacterized protein LOC101260987
TrEMBLA0A3Q7F4890.0A0A3Q7F489_SOLLC; Uncharacterized protein
STRINGSolyc02g078810.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55341924
Representative plantOGRP829569
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42150.12e-13DNA-binding bromodomain-containing protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]