PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g077960.1.1
Common NameLOC104645831
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 300aa    MW: 32213.3 Da    PI: 9.9194
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g077960.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.9e-383793561
              zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +kcprCds+ntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rk k++
  Solyc02g077960.1.1 37 PQKCPRCDSNNTKFCYYNNYSLTQPRYFCKTCRRYWTQGGTLRNVPVGGGCRKGKRT 93
                        689**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-263292IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8633892IPR003851Zinc finger, Dof-type
PfamPF027012.7E-323892IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104076IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MEDQLGGRSS GENDRNQQQR RMKMPENNSA SPAQPPPQKC PRCDSNNTKF CYYNNYSLTQ  60
PRYFCKTCRR YWTQGGTLRN VPVGGGCRKG KRTMKGGGSS SSAGESSSSR SHHQVLYPPQ  120
IPNLSAAAAA FFSGNNSRSQ PPPLPSMSSL YTGAAGGGGF LSSLAAMQSM SQLSQGINNQ  180
SQLGVISGTN NNNNQFGNFN IPTPPPKVQI DQQMESTGFY QKPNLESSFF PSDQTLQFQP  240
ARPLGSWTQR FINNNNNNIW PNNSASNTSS GAASSSAANA SLGPNDHQWP DLPGFGPSP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g077960.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025885168.10.0dof zinc finger protein DOF5.3-like
RefseqXP_025885169.10.0dof zinc finger protein DOF5.3-like
TrEMBLA0A3Q7FQM10.0A0A3Q7FQM1_SOLLC; Uncharacterized protein
STRINGSolyc02g077960.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-33TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]