PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g067230.2.1
Common NameLOC101243956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 468aa    MW: 51282.7 Da    PI: 4.5796
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g067230.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.2e-39113172261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Solyc02g067230.2.1 113 PDKIIPCPRCNSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNS 172
                         7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-30110170IPR003851Zinc finger, Dof-type
PfamPF027011.2E-31115171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.574117171IPR003851Zinc finger, Dof-type
PROSITE patternPS013610119155IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MTDPAIKLFG RTIQLPDIPD SSGAQGDDSL PGDNNGEEDE EADKDDFGGN LDDDEEEMEI  60
LTGKELQDQN SEPTKTDSIK ELPVDNDCST RPSKSEEEQG EASNSQEKIL KKPDKIIPCP  120
RCNSMETKFC YFNNYNVNQP RHFCKSCQRY WTAGGTMRNV PVGAGRRKNK NSIPHYRQIS  180
VSETLSNAQT DYPNGIQQPI LAFGSPTPLC ESMASVLNIA DKTMHNCSQN GFHKPQEPGV  240
PVSYVVGDNG DDHSRRSSVT SANSEDEVNK TVPDLLKKNC HNFPPYMTYY PGAPWPYPCS  300
PVPWNSAIPP PGYCPPGFPM PFYPAASYWG YTVAGSWNVP WMSPATVSLI QTPTTSGPIS  360
PALGKHSRDE NIQKPLSSME EPSNESNPEK CLWVPKTLRI DDPGEAAKSS IWATLGIKHD  420
TVDSVGGSPF SAFQPKNDDN NRVSENSTVL QANPAALSRS VNFNESL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.130490.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g067230.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233366.10.0cyclic dof factor 2
TrEMBLA0A3Q7F0R90.0A0A3Q7F0R9_SOLLC; Uncharacterized protein
STRINGSolyc02g067230.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-90cycling DOF factor 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]