PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g065800.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TCP
Protein Properties Length: 143aa    MW: 16204.5 Da    PI: 9.6825
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g065800.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.41.3e-3043111270
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                          g+kdrhsk+ T +g+RdRRvRls+++a +++dLqd+LG+d++sk ++WLl++ak+ i+el+ ++  ++
  Solyc02g065800.1.1  43 FGGKDRHSKVLTVKGLRDRRVRLSVPTALQVYDLQDKLGLDQPSKVVDWLLNEAKHDIDELPPLQIRDQ 111
                         689***********************************************************9955444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.9945103IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-2945130IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MISREVDPSD NNVIMIPKKS SLSSSSSWTR FKDPRIVRVS RAFGGKDRHS KVLTVKGLRD  60
RRVRLSVPTA LQVYDLQDKL GLDQPSKVVD WLLNEAKHDI DELPPLQIRD QTGLPLTGLR  120
KEEEETMVVS DEDRVKLDVR NT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1950104155Putative transcription factor PCF6
5zkt_B1e-1950104155Putative transcription factor PCF6
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g065800.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2468130.0Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-33h20 map 2, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253504.35e-97transcription factor TCP17-like
SwissprotQ9S7W52e-40TCP13_ARATH; Transcription factor TCP13
TrEMBLA0A494GA561e-95A0A494GA56_SOLLC; Uncharacterized protein
STRINGSolyc02g065800.1.14e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.17e-43plastid transcription factor 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  3. Yamburenko MV,Zubo YO,Börner T
    Abscisic acid affects transcription of chloroplast genes via protein phosphatase 2C-dependent activation of nuclear genes: repression by guanosine-3'-5'-bisdiphosphate and activation by sigma factor 5.
    Plant J., 2015. 82(6): p. 1030-41
    [PMID:25976841]
  4. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]