PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g065340.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 279aa    MW: 32295.9 Da    PI: 10.3935
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g065340.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.71.7e-121872641393
                         TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                  B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                         s  +++pk+fa   g+ k   k+++l + +g++W++  i   +++r+++++GW +F   n++  g ++ Fkl+++++ e+ 
  Solyc02g065340.1.1 187 SFFMTIPKSFAIWTGITK--MKKMRLVNGNGNKWKLVDI-VHTQQRVYMKRGWAGFRTLNRIGNGQTCRFKLIKENCCEYS 264
                         5679*******7778775..558************9874.66677899************************998555454 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.34E-136101IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.3E-126101IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.0E-511103IPR003340B3 DNA binding domain
PfamPF023621.1E-72495IPR003340B3 DNA binding domain
PROSITE profilePS5086311.23724103IPR003340B3 DNA binding domain
CDDcd100171.88E-64998No hitNo description
SuperFamilySSF1019368.44E-15172273IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-15172273IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.601175269IPR003340B3 DNA binding domain
CDDcd100172.95E-7176261No hitNo description
SMARTSM010190.0016178274IPR003340B3 DNA binding domain
PfamPF023625.0E-11186262IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MLVDPNKHPS FCKLLFKQGF MDKIMPPIFI KENKKLLAKT CLLKTNVVGM SWETKIVREN  60
SNYFICEGDW PQFVVHHKLE LGDILIFFLI DKSTFHVLPY SQKTFKNSSG RGAFQELTSS  120
SEEEHDVGIA RKLKKMKMEQ KESSGVVKKE EAEGGKEENV PKTTRFSVIN INNKDPYFEM  180
VVRKTHSFFM TIPKSFAIWT GITKMKKMRL VNGNGNKWKL VDIVHTQQRV YMKRGWAGFR  240
TLNRIGNGQT CRFKLIKENC CEYSVLQVQK IHKSKCLK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g065340.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154040.0Solanum lycopersicum chromosome 2 clone C02HBa0163K16, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233940.30.0B3 domain-containing protein REM9-like isoform X1
TrEMBLA0A3Q7EZQ40.0A0A3Q7EZQ4_SOLLC; Uncharacterized protein
STRINGSolyc02g065340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48881327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.18e-10B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]