PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g065290.1.1
Common NameLOC101260606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 204aa    MW: 21890.4 Da    PI: 8.9516
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g065290.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.5e-392686262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ++++l+cprCds ntkfCyynny+lsqPr+fCk+CrryWt+GG+lr++P+Ggg+rkn k+s
  Solyc02g065290.1.1 26 PDHHLPCPRCDSINTKFCYYNNYNLSQPRHFCKSCRRYWTQGGTLRDIPIGGGSRKNAKRS 86
                        67899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-252284IPR003851Zinc finger, Dof-type
PfamPF027015.2E-342884IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.043084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MTLESSEKLV TKQQTGGVQA PPTQEPDHHL PCPRCDSINT KFCYYNNYNL SQPRHFCKSC  60
RRYWTQGGTL RDIPIGGGSR KNAKRSRIYT NTPFSSTIAS VSSHAVPGNS PFMLPLPAAN  120
QLLFGTDVKP INNFTSLLSS HGPGVLALGG IEDMGFGIGR GNVWPFTGAP DSYSRNYNNG  180
GGAGMWQFSG GEGGFVGSGD YFN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g065290.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153670.0Solanum lycopersicum chromosome 2 clone C02HBa0044L14, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233942.11e-150dof zinc finger protein DOF3.4-like
TrEMBLA0A3Q7F0C41e-149A0A3Q7F0C4_SOLLC; Uncharacterized protein
STRINGSolyc02g065290.1.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.14e-39Dof family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]