PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g061780.2.1
Common NameLOC101257530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 245aa    MW: 28226 Da    PI: 7.6566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g061780.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.31.6e-4591353128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eel+++yLk+ ++++k++  ++i  ++iy ++Pw+Lp +++ +e+ewyfF++ ++k+  + r+nr+t++g+Wkatg+d+++ 
  Solyc02g061780.2.1   9 PGFRFHPTEEELINFYLKRIINDDKIDS-NTIGFLNIYLYDPWELPGMARIGEREWYFFVPINRKHGPKGRPNRTTRNGFWKATGSDRQIR 98 
                         9**************************9.88***************8888999************************************** PP

                 NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         s+   ++++glkktLvfy grapkg++tdWvm+eyrl
  Solyc02g061780.2.1  99 SSiePKRVIGLKKTLVFYGGRAPKGTRTDWVMNEYRL 135
                         99888889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.2037152IPR003441NAC domain
SuperFamilySSF1019411.01E-538152IPR003441NAC domain
PfamPF023654.7E-259135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSLAELELPG FRFHPTEEEL INFYLKRIIN DDKIDSNTIG FLNIYLYDPW ELPGMARIGE  60
REWYFFVPIN RKHGPKGRPN RTTRNGFWKA TGSDRQIRSS IEPKRVIGLK KTLVFYGGRA  120
PKGTRTDWVM NEYRLPHGHK DHDIVLCKVY RKATSFKVLE ERAMIEEDEA KKTYLASAPH  180
DESQDMLASL NSSSSKNDMY FKSCEEKNDE LLGSNAFVEP SKFSIDSLSS PLWSTGQDLW  240
TLFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-42315515171NAC domain-containing protein 19
3swm_B1e-42315515171NAC domain-containing protein 19
3swm_C1e-42315515171NAC domain-containing protein 19
3swm_D1e-42315515171NAC domain-containing protein 19
3swp_A1e-42315515171NAC domain-containing protein 19
3swp_B1e-42315515171NAC domain-containing protein 19
3swp_C1e-42315515171NAC domain-containing protein 19
3swp_D1e-42315515171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g061780.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010317253.10.0NAC domain-containing protein 22-like
SwissprotQ10S659e-81NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A3Q7F0600.0A0A3Q7F060_SOLLC; Uncharacterized protein
STRINGSolyc02g061780.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35312248
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.12e-80NAC domain containing protein 36
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]