PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g036430.1.1
Common NameLOC101257320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 566aa    MW: 64873.1 Da    PI: 5.1193
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g036430.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.3e-5661341129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd
  Solyc02g036430.1.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPdKsLLPSKDMEWYFFSPRDRKYPNGTRTNRATKAGYWKATGKD 95 
                         79****************************.99**************96435566888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         ++v s + + +g+kktLv+y+grap+g++t Wvmheyrle
  Solyc02g036430.1.1  96 RKVNS-QMRPIGMKKTLVYYRGRAPHGTRTGWVMHEYRLE 134
                         ****9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-634156IPR003441NAC domain
PROSITE profilePS5100561.6016156IPR003441NAC domain
PfamPF023653.7E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEVIPE VDLYKCEPWD LPDKSLLPSK  60
DMEWYFFSPR DRKYPNGTRT NRATKAGYWK ATGKDRKVNS QMRPIGMKKT LVYYRGRAPH  120
GTRTGWVMHE YRLEERECEV ANGLQDAYAL CRVFKKSLNV PKIGDHYGSD RSGCSINDQL  180
YTEGRGEDCD YGMMTTTTSS SSRLLHGSPL MNHAAPTPTN DDNKWMQYLS DEANYTFNNN  240
PSFATNGHFP YNHPSKVDIA LECARLQHRF ALPPLEVQDF PQVGYVMSQS NDVMYHQSTT  300
SQTDIVQEIL SVAQASHDLT NQEYSWDGNY NNINYGDDFS FLPHSHNNNH DLGNSFNFMD  360
QLKEDDDQNN SIPIADFDED FKSETMVERL RWVGMSQKDD KAFLEDYKTV PIENISGPHK  420
EEQDQLQGEA SGQQNNMNET EANNFSLGFG NDDNFLDDEE TDGFSSSPSF EVYEKIEVNQ  480
GMFIATRQVA NTFYHQVAPS KTVTIHRDMV TMHDFPIRKI TKSATFLDTF MAFSRKTLSR  540
VVMRVNTLVE LIAPLHTFWT ILENA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-55116215174NAC domain-containing protein 19
3swm_B2e-55116215174NAC domain-containing protein 19
3swm_C2e-55116215174NAC domain-containing protein 19
3swm_D2e-55116215174NAC domain-containing protein 19
3swp_A2e-55116215174NAC domain-containing protein 19
3swp_B2e-55116215174NAC domain-containing protein 19
3swp_C2e-55116215174NAC domain-containing protein 19
3swp_D2e-55116215174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g036430.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2467410.0Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-55o9 map 2, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010315723.10.0NAC domain-containing protein 86-like
TrEMBLA0A3Q7FIB50.0A0A3Q7FIB5_SOLLC; Uncharacterized protein
STRINGSolyc02g036430.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Representative plantOGRP87171015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-147NAC domain containing protein 28
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]