PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g036370.2.1
Common NameLOC101261079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 465aa    MW: 50960.9 Da    PI: 6.7145
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g036370.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.71.9e-1657101147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rW++eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  Solyc02g036370.2.1  57 RERWSEEEHKKFLEALKLHGRA-WRRIEEHVG-TKTAVQIRSHAQKF 101
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.93E-1651105IPR009057Homeodomain-like
PROSITE profilePS5129421.20452106IPR017930Myb domain
TIGRFAMsTIGR015572.8E-1555104IPR006447Myb domain, plants
SMARTSM007175.5E-1356104IPR001005SANT/Myb domain
PfamPF002496.5E-1457100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-95797IPR009057Homeodomain-like
CDDcd001673.00E-1059102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MTIGDQSESD SILPCRNRMS VDVGAPSPRS IQMDEQVNPG EEYAPKIRKP YTISKQRERW  60
SEEEHKKFLE ALKLHGRAWR RIEEHVGTKT AVQIRSHAQK FFSKVVRESS NGDASSVKSI  120
EIPPPRPKRK PMHPYPRKMA TPLKSGTLAS EKLNRSGSPD LCLSEPENQS PTSVLSTLGS  180
DAFGTVDSTK PSEQSSPVSS AVAENSGDLV LSEPFDLVVE ESRSSPARAY ATSNPANQAC  240
VKLELFPEDN DFVKEGSDEA SSTQCLKLFG KTVLVTDAHM PPTDETLTRS SFPAKYLPWD  300
SECPQSTFSI VPPTPSYYFT TPNGSSGPNQ SGVATTHLPW GSSCAVPCTQ VHSPIPMKGR  360
PLFNDRYLEG KETQKEGSST GSNAESVDAE LSGEKNMEIE AQSSRNVVEE SVRASVPSLF  420
ERRANSTKRV KGFVPYKRCL AERGVSSSTL TGEEREEQRT RLCL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.28860.0callus| flower| fruit| leaf| root| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g036370.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2466950.0Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-40g4 map 2, complete sequence
GenBankAC2467180.0Solanum lycopersicum strain Heinz 1706 chromosome 2 clone sle-5e16 map 2, complete sequence
GenBankAC2467290.0Solanum lycopersicum strain Heinz 1706 chromosome 2 clone hba-36d16 map 2, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004231624.10.0protein REVEILLE 1
TrEMBLA0A3Q7EXN40.0A0A3Q7EXN4_SOLLC; Uncharacterized protein
STRINGSolyc02g036370.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-70MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]