PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g112190.2.1
Common NameLOC101256430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 842aa    MW: 93298.5 Da    PI: 7.5675
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g112190.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.3e-29542592252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Solyc01g112190.2.1 542 EKSISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 592
                         799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.427531612IPR003035RWP-RK domain
PfamPF020429.7E-25545592IPR003035RWP-RK domain
SuperFamilySSF542773.93E-21743829No hitNo description
Gene3DG3DSA:3.10.20.2402.3E-20745826No hitNo description
SMARTSM006665.6E-23746829IPR000270PB1 domain
PROSITE profilePS5174521.927746829IPR000270PB1 domain
PfamPF005642.2E-16747828IPR000270PB1 domain
CDDcd064073.06E-40747828No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MEDAAFTLLA KLHDDNNATD FTEFGFWLEA TDQPSNSNSN YCTSNQMDSA PPTQSRRKLW  60
IGPNNPNPTS SIPPVNTRLV QAIEYLKNST THNKEVLIQI WVPVNRGGKH VLITNNQPYF  120
LNPNSHSLLQ YRNVSQNYQF AADKDSNELV GLPGRVFLKK LPEWTPDVRF FKSEEYPRVN  180
YAHQHNVRGS IAVPVFETGS GTCLGVVEIV TTIQKTHYHL ELEHVCKALE AVNLRSSGIS  240
SNPSKIKDQD CNESYLAALA EIQYILTCVC DTHKLPLAQT WAPCIQQGKG GCLQSDENFA  300
SCVSTVDSSC YVRDQHVVPF HLACSEHHLL KGEGVAGGAF NTNQPCFATD ITAFSKAEYP  360
LSHHARMFGL CSAVAIRLRS IYTGSADFVL EFFLPLDCKN TEEQKIMLSS LSSVIQQSCR  420
SLRVVTDQEL QEEKEVVRLP IGEEESRKPV SSSYRDQDAS SWLSEMLDAQ RKGKGAAAVS  480
ENFKVTATPW DYTQRESIHA STFSEPNQTF EPKGGSFDFS SGTGSHSSGA KRAGERRRSK  540
TEKSISLQVL RQYFAGSLKD AAKSIGVCPT TLKRICRQHG ITRWPSRKIK KVGHSLQKLQ  600
LVIDSVHGAE GAIKLSSFYT NFPELNSPNN PGTSNFSASK NDDHLQQVNT QPDGSPVTTT  660
SKSTSSSGSH NSSSSLFCST GSKNCTTEEN PGGMPKRAHT ETGLHDMGQE ETKLLVRSQS  720
QKIQSNHNSV EPVCPLSTSS NQVLGRFKVK AIFGKEKIRF SLQSHWGFRD VKHEVMRRFN  780
VEDVGKIDLK YLDDDDEWVL LTCDADLEEC IDIHKFSKRR TIKVSLHHTN LGSSFGSSGP  840
A*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g112190.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401980.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-219g5 map 1, complete sequence
GenBankAC2465860.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-20o20 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004231096.10.0protein NLP2
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A3Q7EUL60.0A0A3Q7EUL6_SOLLC; Uncharacterized protein
STRINGSolyc01g112190.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]