PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g110480.2.1
Common NameLOC101250636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 583aa    MW: 63703.5 Da    PI: 7.3965
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g110480.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64.1e-11421479563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l  l+  +  l+s++
  Solyc01g110480.2.1 421 KRAKRILANRQSAARSKERKMRYIAELEHKVQTLQTEATTLSAQLTLLQRDATGLTSQN 479
                         9************************************************9999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-18417481IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898419482IPR004827Basic-leucine zipper domain
PfamPF001702.1E-9421479IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-11421478No hitNo description
SuperFamilySSF579595.42E-11421472No hitNo description
CDDcd147036.40E-24422471No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MAGDNDEGHS DMVQRLQSSF GTSSSSLPKQ LQPISMNQLD IPQLTTSQFR GQMRQFSPNF  60
GVENSKRVGI PPSHPQMPPI SPYSQIPVTR PGNQQMGMQN FTSAGPSHSR SLSQPAFFSL  120
DSLPPLSPSP YRESPSTSMS DPISADVSMG DQDGNSHSLL PPTPFSRCNS SRAGESLPPR  180
KAHRRSNSDI PFGFSGIMQS SPPLVPLRSP GALERSVPSR DNLGGKPVQL VKRESMWERG  240
NDNNNVEGMG ERKSEGEVVD DLFSAYMNLD NIDAFNSSGT DEKLGIENRE DLDSRASGTK  300
TNGGDSSDNE ATSSVNDSSS GSMQKREGVK RSAVGDIAPT TRHYRSVSMD SFMGKLNFID  360
DSPKLPPSPG PRPGQLSPTN SLDGNSNSFS LEFGNGEFSG AELKKIMANE KLAEIALADP  420
KRAKRILANR QSAARSKERK MRYIAELEHK VQTLQTEATT LSAQLTLLQR DATGLTSQNS  480
ELKFRLQAME QQAQLRDALN EALTAEVQRL KIATAELSAD ASKFQQLSLN PQMFQSQQQQ  540
SNQLNMHQLQ QQQQQQQSSQ PQQHAQARQQ LNSSTTSKHE SK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.42960.0callus| cell culture| flower| fruit| leaf| seed| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g110480.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145760.0Lycopersicon esculentum clone 134031F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230901.10.0probable transcription factor PosF21
RefseqXP_015062011.10.0probable transcription factor PosF21
TrEMBLA0A3Q7ETM70.0A0A3Q7ETM7_SOLLC; Uncharacterized protein
STRINGSolyc01g110480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-138bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]