PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g110310.2.1
Common NameLOC101260878
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GATA
Protein Properties Length: 326aa    MW: 35912.3 Da    PI: 6.5106
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g110310.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.5e-19243276134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         C++C++ kTp+WR gp g+ktLCnaCG++y++ +
  Solyc01g110310.2.1 243 CTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGR 276
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.8E-835321IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.308237273IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-14237287IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-15239300No hitNo description
Gene3DG3DSA:3.30.50.101.4E-14240274IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.08E-13242299No hitNo description
PfamPF003201.0E-16243276IPR000679Zinc finger, GATA-type
PROSITE patternPS003440243268IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MELIEARALK SSFLSDMAMK NTQQVFLDDI WCVTGINNGA SEDFSVDDLL DFSDKDFKDP  60
ELHEDDEKTS FSGSSQKRNS QDSTFSGMES FGSLAGELPI PVDDMENLEW LSQFVDDTPS  120
EFSLLCPTES FKDKTGGFTE SRSEPVVRPV VKKTRVPCFP LPFPVKPRSK RSRQAGRTWS  180
FPSSAVSGDS SSPTSSSYGS SPFPSGFFTN PVYDGDLFCS VEKPPLKKPK KNPSVETGSG  240
RRCTHCQVQK TPQWRAGPLG PKTLCNACGV RYKSGRLFPE YRPACSPTFS LEVHSNSHRK  300
VLEMRRKKET GEGIDSGLAS MISTC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.125470.0callus| cell culture| floral bud| flower| fruit| leaf| trichome
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g110310.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230938.10.0GATA transcription factor 5
TrEMBLA0A3Q7ETJ30.0A0A3Q7ETJ3_SOLLC; GATA transcription factor
STRINGSolyc01g110310.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11542481
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.15e-44GATA transcription factor 4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]