PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g109880.2.1
Common NameZIP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 164aa    MW: 18656.8 Da    PI: 6.2648
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g109880.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.52.5e-123088563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +r+++NRe+ArrsR RK++ ++ L   v +L +eN +    ++  ++++ ++++e+
  Solyc01g109880.2.1 30 RKRKRMISNRESARRSRMRKQKHLDDLMSQVTNLRKENNQILTSMNVTTQHYLNVEAEN 88
                        6789***********************************99999888888888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-101971No hitNo description
SMARTSM003383.2E-172690IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3122891IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.38E-123082No hitNo description
PfamPF001709.9E-103072IPR004827Basic-leucine zipper domain
CDDcd147021.31E-173181No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSGTSSG SSFIQNSGSE EDLQQLMDQR KRKRMISNRE SARRSRMRKQ KHLDDLMSQV  60
TNLRKENNQI LTSMNVTTQH YLNVEAENSI LRAQLSELSR RLESLNEIIA VLDANSGLVM  120
DHNEPYSFNF AQNDIMFDGF NVTNSWNYLS ANQPIMTADV LQY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12950RKRKRMISNRESARRSRMRKQK
24249RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.31260.0flower| fruit| seed| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269|PubMed:23461773}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g109880.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ6471900.0Solanum lycopersicum bZIP transcription factor (ZIP) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233865.11e-117bZIP transcription factor
SwissprotC0Z2L51e-45BZP44_ARATH; bZIP transcription factor 44
TrEMBLC0KYN11e-115C0KYN1_SOLLC; BZIP transcription factor
STRINGSolyc01g109880.2.11e-116(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.18e-33basic leucine-zipper 44
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]