PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g108940.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family B3
Protein Properties Length: 373aa    MW: 43605 Da    PI: 6.6047
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g108940.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.17.6e-14893494
                        E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT.--TT-EEEEEE-SSSEE..EE CS
                  B3  4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkang.LkegDfvvFkldgrsefelvv 94
                        ++  +  ++ +r+ +p ++a ++ +gk   ++ + ++d+ ++ W + +  +k  g+ ++++GWk+F ++n+ L+ gDf++F +dg+++f ++v
  Solyc01g108940.1.1  8 IF--NPESSAKRMKIPSSYA-TYkNGK--LPRNVFFRDRFNNMWPMGV--TKIEGALYFENGWKKFIEDNNtLEYGDFMIFDYDGNETFDFKV 93
                        55..445566789*******.553555..7789***************..******************986489***********99995554 PP

2B330.85.3e-102453131283
                         HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
                  B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                         ++++ ++p + +++++++   +  ++++d+ gr++e k++y+k + r++l +GW++ ++ n ++ +D++ F+
  Solyc01g108940.1.1 245 RRNQQYVPIDVVRDYKLE--LPPSMIIRDSAGREFETKVKYWKDG-RIWLVGGWRSICRWNLVEKNDSLQFT 313
                         567788999999999766..55679*****************996.899**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.5E-16399IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.193397IPR003340B3 DNA binding domain
SuperFamilySSF1019366.47E-17599IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.4E-8597IPR003340B3 DNA binding domain
CDDcd100171.05E-10594No hitNo description
PfamPF023622.1E-11893IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.6E-14229314IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-14231313IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.107234330IPR003340B3 DNA binding domain
CDDcd100173.90E-7235313No hitNo description
SMARTSM010190.0055237330IPR003340B3 DNA binding domain
PfamPF023621.0E-8245313IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MEKGFFRIFN PESSAKRMKI PSSYATYKNG KLPRNVFFRD RFNNMWPMGV TKIEGALYFE  60
NGWKKFIEDN NTLEYGDFMI FDYDGNETFD FKVLEMSGCV KEGAKCEKKK EVYVEHRKSV  120
EPKEKNRIGD NNDSSSDDDN ANNYMIEEEE SNVKEEVEKE EEEDREEKET MEEVEDEAEE  180
EEDEEEIETT QTFKKRRSGS KAGRRKAITC KVRNMIDRHG IDIFRSGSAT KPKNPYFVAK  240
IIAKRRNQQY VPIDVVRDYK LELPPSMIIR DSAGREFETK VKYWKDGRIW LVGGWRSICR  300
WNLVEKNDSL QFTTRIFSNN GLERQVKSTD MIKNQQASIY DRGSSVKGQK NTLTLQNSLN  360
RLLLTVKATQ LK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g108940.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2384990.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-8l19 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089724.11e-177B3 domain-containing protein At5g60140-like
TrEMBLM1AQ141e-107M1AQ14_SOLTU; Uncharacterized protein
STRINGSolyc01g108940.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10912264
Representative plantOGRP8585614
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53310.12e-14B3 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]