PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g108300.2.1
Common NameLOC101243935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 406aa    MW: 45059.3 Da    PI: 8.1463
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g108300.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.84.9e-33261316156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Solyc01g108300.2.1 261 KQRRCWSPELHRRFVDALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 316
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-30258320IPR009057Homeodomain-like
PROSITE profilePS5129414.362258318IPR017930Myb domain
SuperFamilySSF466892.19E-18259319IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-27261316IPR006447Myb domain, plants
PfamPF002495.0E-8263314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGSIPAELSL DCRPSFIPKS ITDFLRQLSL IRNVPDKLSQ IDDYITRLED EMRKIDAFKR  60
ELPLSVLLVK DAIVALREES MQYRKSRTEP VLEEFIPLKK SSREDTKAEI TKDKDSREKM  120
SWMSSVQLWN SESHCENTDE AINKQQSKSE LKDTQRSPEE GNSSVTEDPF QSCKTMNAAK  180
AFSVPFKGYS GFSVTAVRKD NKDELPGLSL HTPGITKLRE DTVTSGLNSK HSGSRGGLSS  240
VAGCQSNMRT GSLAQQQSSR KQRRCWSPEL HRRFVDALQQ LGGSQVATPK QIRELMQVDG  300
LTNDEVKSHL QKYRLHTRRI PNSQTQPANQ SGVALGNLWM SQGQYGESSK QSSSQSGSPQ  360
GPLHLAGSCG GTSTTVGDSM DEEDDVKSEN HSWKNHVHTS GKVDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.148090.0flower| fruit| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g108300.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001297051.10.0Myb family transcription factor
TrEMBLA0A3Q7EST30.0A0A3Q7EST3_SOLLC; Uncharacterized protein
STRINGSolyc01g108300.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-58G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]