PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g104650.2.1
Common NameLOC101258010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 298aa    MW: 32080.1 Da    PI: 8.2417
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g104650.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.37.9e-14216270458
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                          +++rr++kNRe+A rsR+RK+a++ eLe  v +Le+eN +L  e ee +ke  k
  Solyc01g104650.2.1 216 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLLREEEEKNKERLK 270
                         589**************************************99888777776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.1E-13211275No hitNo description
SMARTSM003389.4E-10213277IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.116215267IPR004827Basic-leucine zipper domain
PfamPF001702.5E-12216268IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.81E-10217268No hitNo description
CDDcd147073.97E-22217257No hitNo description
PROSITE patternPS000360220235IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MASKVMPSAS TTPNSDRSLH PQNPSSSLNH SHPSRNFDSM NMDEILKNIY SDSDPFACSV  60
SATAAVHTPS ATAAGVGDVG PTKTVDEVWR EIVAGGGGGG GSREPEMTLE DFLTKAGAVT  120
EEDVRVPVIA PPPPPPPPPA TGAPSARGFV VDNMMGTGNC QFPVAMQNGP GGYGMEPQPH  180
MGFGNGVVAI TGSGSGSGRG KRRSTVEELP ADRATQQKQR RMIKNRESAA RSRERKQAYT  240
VELESLVTQL EEENARLLRE EEEKNKERLK QIMENLIPVV EKRRPPRVLR RVRSMSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.66340.0flower| fruit| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g104650.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2326221e-07Solanum lycopersicum chromosome 7 clone C07HBa0025K11, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230593.10.0bZIP transcription factor 12 isoform X1
TrEMBLA0A3Q7EQU80.0A0A3Q7EQU8_SOLLC; Uncharacterized protein
STRINGSolyc01g104650.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27712452
Representative plantOGRP8662715
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.18e-20G-box binding factor 4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]