PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g103840.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 85aa    MW: 9529.72 Da    PI: 6.772
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g103840.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer54.72.4e-171164458
         ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                        v+Y eC++N Aa+  g+++DG gEf+p+ g+  t + + CaA  CH nFH++ ++
  Solyc01g103840.1.1 11 VKYLECRHNYAARSNGYVLDGYGEFCPT-GAPETLEFFICAAWHCHQNFHKKVEV 64
                        79*************************9.66679*****************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-81159IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.8E-171163IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-151261IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152316.5761362IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MASNNNKHFL VKYLECRHNY AARSNGYVLD GYGEFCPTGA PETLEFFICA AWHCHQNFHK  60
KVEVEVENKV ESPVISINPS HGTC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g103840.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015088823.11e-43zinc-finger homeodomain protein 4-like
TrEMBLA0A3Q7ERK81e-56A0A3Q7ERK8_SOLLC; Uncharacterized protein
STRINGSolyc01g103840.1.12e-57(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2648622
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.14e-12homeobox protein 24
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]