PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g103830.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 211aa    MW: 24492.3 Da    PI: 10.1825
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g103830.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer729.4e-231164458
         ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                        v+Y eC++N Aa+  g+++DGCgEf+p+ g+  t +++ CaAC CHRnFHR+ ++
  Solyc01g103830.1.1 11 VKYLECRHNYAARSNGYVLDGCGEFCPT-GALETLESFICAACHCHRNFHRKVEV 64
                        79*************************9.6668*******************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-121173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-201163IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.1E-201261IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152320.3191362IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.9E-6134197IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MASNNKKYFL VKYLECRHNY AARSNGYVLD GCGEFCPTGA LETLESFICA ACHCHRNFHR  60
KVEVELEDGV ESPIISINHP SRGTPLVIID DPPLQYTVKS RAQFCETSKK NNIDVETKMK  120
RDIGEIKVRK LKRKYNASSS KRMRLNPYQR ERIWIFANEI MRWKWTKSNE QVIPFCDEIG  180
IAPKFLKNWI NNTKSRTRPL AKNGHVRNKK *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g103830.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015054791.11e-149zinc-finger homeodomain protein 4-like
TrEMBLA0A3Q7EQA51e-136A0A3Q7EQA5_SOLLC; Uncharacterized protein
STRINGSolyc01g103830.1.11e-157(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA108891118
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.24e-26homeobox protein 31
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]