PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g097330.2.1
Common NameLOC101261751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 455aa    MW: 48614.8 Da    PI: 6.6882
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g097330.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.3e-16249304358
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                         + kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN++L k+l  +++++ +
  Solyc01g097330.2.1 249 DTKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNE 304
                         679*****************************************999999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-12246302No hitNo description
SMARTSM003383.1E-19247311IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.679249304IPR004827Basic-leucine zipper domain
PfamPF001701.4E-13250303IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-11251301No hitNo description
CDDcd147023.01E-6252303No hitNo description
PROSITE patternPS000360254269IPR004827Basic-leucine zipper domain
PfamPF124983.5E-47318443IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MDRVFSVDDD IGDHFWSTPP TAELGVDSPT SAAAAAAISY SKMMNRSSSE WAFQRFLLEA  60
AGAAGTTTSS PPQPPTMASS SSSSHQNDVV EIKDENLSTP NLNSGTALNS KPAATLFGSA  120
TPQNIHVDAE EYQAFLKSRL DLACAAVALT RAKNLKPQDA SSIAPDKGPE TASASQSVSH  180
ITSKGSGQEV RKVQDKDSGG PVGIPSLPAV QKKPGVQVKS TTSGSSRELS DDDEAEGEAE  240
TTQGTDPADT KRVRRMLSNR ESARRSRRRK QAHLTELETQ VSQLRVENSS LLKRLTDISQ  300
KYNESAVDNR VLKADVETLR AKVKMAEETV KRVTGLNPLF QAMSEMSSMA MPSFSGSPSD  360
TSTDTAVPVP DDSQHHYYQQ PPNNHMPTHD PRIQNGMVDV PTIGTVQQNP AAAAVGGNKM  420
GRTASMQRVA SLEHLQKRIR GEVSSCGTQG RGEQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1263270RRSRRRKQ
2265270SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.109000.0callus| flower| leaf| root
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g097330.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2394340.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-286k14 map 1, complete sequence
GenBankAC2395800.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-319d11 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230097.10.0light-inducible protein CPRF2
SwissprotQ990901e-146CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLA0A3Q7ENB40.0A0A3Q7ENB4_SOLLC; Uncharacterized protein
STRINGSolyc01g097330.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29342444
Representative plantOGRP18391639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-64bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Weisshaar B,Armstrong GA,Block A,da Costa e Silva O,Hahlbrock K
    Light-inducible and constitutively expressed DNA-binding proteins recognizing a plant promoter element with functional relevance in light responsiveness.
    EMBO J., 1991. 10(7): p. 1777-86
    [PMID:2050115]