PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g096710.2.1
Common NameLOC101246965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YC
Protein Properties Length: 277aa    MW: 30883.4 Da    PI: 5.1691
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g096710.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.21.8e-186861898
               NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                        ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  +     +t++   ++ +v++ ++fdfl ++v +
  Solyc01g096710.2.1  6 DTRFPAARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDRTYDITLRRGAKTVNSLHLKHCVQSYNVFDFLREVVSK 86
                        5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-26372IPR009072Histone-fold
SuperFamilySSF471132.37E-204100IPR009072Histone-fold
PfamPF008081.7E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIAMA VPVLVSKALE LFLQDLCDRT YDITLRRGAK  60
TVNSLHLKHC VQSYNVFDFL REVVSKVPDY GHSDAAGEMP KRRKVAIEEH HDSEDEYKKS  120
RTEMSPVGSS GRGRGRGRGR GRGRVSRADK ELSRPDMQLE SCTSAQQSVQ QNPNPGTQTE  180
NCSEPKESPT QDSTVCDKEN SVVTTPNLKV NVDDNTDKPA APEIAPCNPS PRPVNEKAEE  240
GPQWSLEMDR MVIDPAHMSQ LNTSVAEEEE DYDEEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A8e-22272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133142RGRGRGRGRG
2133143RGRGRGRGRGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.140050.0flower| fruit| leaf| trichome
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g096710.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0141430.0Lycopersicon esculentum clone 133262F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230049.10.0dr1-associated corepressor isoform X1
TrEMBLM0ZUP51e-173M0ZUP5_SOLTU; Uncharacterized protein
STRINGSolyc01g096710.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79602230
Representative plantOGRP21791635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.17e-67nuclear factor Y, subunit C11
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]