PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g096120.2.1
Common NameLOC101257011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 277aa    MW: 29843.1 Da    PI: 9.5591
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g096120.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.3e-393392362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        + a++cprC+s ntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ s
  Solyc01g096120.2.1 33 DGAINCPRCNSINTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNKRLS 92
                        56799****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-282690IPR003851Zinc finger, Dof-type
PfamPF027019.9E-343590IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8353690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MESTQWSTHE EIGVVKSSMG AEIMNKKVRP VKDGAINCPR CNSINTKFCY YNNYSLTQPR  60
YFCKTCRRYW TEGGTLRNVP VGGGSRKNKR LSSSSSSSQK LPDLNPNPTS HHQNPNNIVI  120
GSNQDLTLGF RTVPQDHHTS FHGVIPQFLE FPKMDGSNNH LGSRTGIASR GFTSFISSAS  180
TPDLNALYNS GFPFQEIKPS AGNADHAASL SNSNYSSGGP GGLENGSGAR IMFPLGGLKQ  240
LSSTNQVDHL TKGQENNNST AGLYWSGMIS GTGGSW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g096120.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331200.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004229998.10.0dof zinc finger protein DOF2.5-like
TrEMBLA0A3Q7ELV10.0A0A3Q7ELV1_SOLLC; Uncharacterized protein
STRINGSolyc01g096120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.45e-53Dof family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]