PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g095640.1.1
Common NameLOC104649435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 95aa    MW: 11458.2 Da    PI: 9.3794
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g095640.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-093272345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        r++++E++l+++ +k+ G + W +Ia +++ gRt++++  +w 
  Solyc01g095640.1.1 32 RMSKQEEDLIYRMHKLVGDR-WGLIAGRIP-GRTAEEIERFWI 72
                        689***************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.4E-72977IPR001005SANT/Myb domain
CDDcd001671.50E-63271No hitNo description
PfamPF002491.1E-83372IPR001005SANT/Myb domain
SuperFamilySSF466894.26E-83473IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-113472IPR009057Homeodomain-like
PROSITE profilePS500906.1443471IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MDQNLHHRHK LMHHRCCSHE EEVNSMEWEF IRMSKQEEDL IYRMHKLVGD RWGLIAGRIP  60
GRTAEEIERF WIMRHSDGFA HKRRQTIKKS LPPT*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}.
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g095640.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389263e-70Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-330o5 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010326918.14e-65transcription factor TRY
SwissprotQ8GV055e-33TRY_ARATH; Transcription factor TRY
TrEMBLK4AZV39e-64K4AZV3_SOLLC; MYB-like transcriptional factor TRY
STRINGSolyc01g095640.1.12e-64(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117071824
Representative plantOGRP4207823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.12e-35MYB_related family protein
Publications ? help Back to Top
  1. Perazza D, et al.
    Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes.
    Genetics, 1999. 152(1): p. 461-76
    [PMID:10224275]
  2. Scheres B
    Plant patterning: TRY to inhibit your neighbors.
    Curr. Biol., 2002. 12(23): p. R804-6
    [PMID:12477405]
  3. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  4. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  5. Brininstool G, et al.
    Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development.
    BMC Plant Biol., 2008. 8: p. 58
    [PMID:18485217]
  6. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  7. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]
  8. Nayidu NK, et al.
    Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae.
    PLoS ONE, 2014. 9(4): p. e95877
    [PMID:24755905]
  9. Taheri A, et al.
    A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population.
    Plant Biol (Stuttg), 2015. 17(2): p. 384-94
    [PMID:25348773]
  10. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  11. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  12. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]
  13. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  14. Kohanov√° J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]
  15. Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R
    Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots.
    PLoS ONE, 2018. 13(10): p. e0205522
    [PMID:30308079]
  16. Kribii R, et al.
    Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway.
    Eur. J. Biochem., 1997. 249(1): p. 61-9
    [PMID:9363754]