PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g095030.2.1
Common NameLOC101257705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 332aa    MW: 37039 Da    PI: 9.9612
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g095030.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1368112147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Solyc01g095030.2.1  68 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 112
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1662118IPR009057Homeodomain-like
PROSITE profilePS5129415.40863117IPR017930Myb domain
TIGRFAMsTIGR015571.5E-1866115IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-666118IPR009057Homeodomain-like
SMARTSM007175.3E-1167115IPR001005SANT/Myb domain
PfamPF002492.7E-1168112IPR001005SANT/Myb domain
CDDcd001672.05E-870113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MVSVYPTPPG QDFHYMGDPM KTGLMGLHPV QSGTSIHGNL NLDSNTGLVV SDDHSKKTRK  60
PYTITKSRES WTEQEHDKFL EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ KYFLKVQKSG  120
TSEHVPPPRP KRKASHPYPQ KAPKKVISQV GSIQFQPPGA LPVPGFGIGP DPLSVPGNTI  180
NFSPWTYDNV PAISTIQTRK DDAQLSSGGV KQNCSSSSNE NNPRINKTKE SNDQNESQKQ  240
MKVMPDFAQV YSFIGSVFDP STRDHLQRLK KMDPIDIQTA LMLMKNLSFN LSSPEFEDHR  300
RMLSSYGLGA EKDKMDLPIK SDFRGNAIRA I*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.172750.0fruit
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. The ARS1 tomato gene contributes to reducing transpirational water loss under salt stress.
    [PMID: 26578112]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g095030.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001340693.10.0R1-MYB type transcription factor ARS1
SwissprotQ8H0W37e-98RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A3Q7EM190.0A0A3Q7EM19_SOLLC; Uncharacterized protein
STRINGSolyc01g095030.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-100MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Campos JF, et al.
    The tomato mutant ars1 (altered response to salt stress 1) identifies an R1-type MYB transcription factor involved in stomatal closure under salt acclimation.
    Plant Biotechnol. J., 2016. 14(6): p. 1345-56
    [PMID:26578112]
  4. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]