PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g091810.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 579aa    MW: 65235.8 Da    PI: 5.1535
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g091810.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.61.8e-25193246155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k r++Wtp++H++F++a++ L G ekA+Pk+i+e+m+ +gLt+ehv+SHLQkYR+
  Solyc01g091810.1.1 193 KRRVVWTPKMHQSFLQAIQYL-GYEKAVPKKIVEIMNEPGLTREHVASHLQKYRM 246
                         689******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.3E-1114155No hitNo description
SuperFamilySSF521721.12E-81498IPR011006CheY-like superfamily
Gene3DG3DSA:1.10.10.601.5E-25191250IPR009057Homeodomain-like
SuperFamilySSF466896.63E-18192250IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-24193246IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MDIPANSSVM GTKNICILLV LDDFTCHNIV SDMLHNQTYQ VLHVGKTMDT LNAVWERKSI  60
FNLVLTNIHR LNTNGVDILQ IIKNKLNLPT IFMSPDDTRC ENQVQDCSVG AYVVSFSDTN  120
EMNKFWQMVL EKEKGRKTVV NQEENDSRLP QNVTAETSRE NTTSADTDVA IKAHDLKGKR  180
KANSEENRDI EKKRRVVWTP KMHQSFLQAI QYLGYEKAVP KKIVEIMNEP GLTREHVASH  240
LQKYRMCIKR AQESSAASIY DQILTNDANA KCFQVQPYLS PLNFSGSRGY AHSIQQPFQN  300
HFQQGTGGMN CPTSGQMGSF QQQNSLLDLQ QADHNGLIGQ HSTFMPRIAH NSNFRVYGDK  360
RKNMLFSIQS GNENQPTNSS NSDLEFLGFR LSTDGKSVNF GHKSSSCTVI PNNAYSGLCS  420
SISEDYIHKQ QSSPKFLETP IENTLIQSSS VQPENLTFNH TSNSISQQQN LLLFDNAENT  480
ISCQIPEIPD SFIPQEQLAP QPSSKDLEDY SAILFGDDEV YVPSLENYDS IQQQYSAPEL  540
PQITLEANSL GTEIDIKSLL ETTEDRSTQL FWEDNEFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-17191250362ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178194KRKANSEENRDIEKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g091810.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015168044.10.0PREDICTED: two-component response regulator ARR14-like
TrEMBLK4AZC10.0K4AZC1_SOLLC; Uncharacterized protein
STRINGSolyc01g091810.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36591620
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-34response regulator 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]