PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g091540.1.1
Common NameLOC104649060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 421aa    MW: 46582.2 Da    PI: 9.3129
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g091540.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC67.41.9e-21121164145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRC+r+v++g+k+C  H+hrg  rsrk++e+
  Solyc01g091540.1.1 121 DPEPGRCRRTDGKKWRCKRDVIPGQKYCGQHVHRG-RRSRKPVEA 164
                         79*********************************.688998886 PP

2WRC581.6e-18311349240
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsr 40 
                         +++ rCrR+DGKkWRCs++v++ +k+CE H+hrg +r+r
  Solyc01g091540.1.1 311 SDEQRCRRSDGKKWRCSKTVVPCQKYCETHMHRGANRKR 349
                         6889********************************997 PP

3QLQ47.65.1e-175793137
                 QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        s FT aQ+q+L  Q+ ++KyL++++PvP +L ++i++
  Solyc01g091540.1.1 57 SVFTEAQFQELQLQAVIFKYLVSGLPVPFHLFFIIWN 93
                        67*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-75793IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.4685893IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.9E-125992IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.67121165IPR014977WRC domain
PfamPF088798.2E-18122161IPR014977WRC domain
PROSITE profilePS5166720.714310354IPR014977WRC domain
PfamPF088795.0E-16312349IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MQLHLFSATP LSLSGKGKED EIKKKKGSPP CIELSLGYGS SSHVVEEDGK DDKSSNSVFT  60
EAQFQELQLQ AVIFKYLVSG LPVPFHLFFI IWNSVSSSLG DGGIYKLYPT LGRFDYTSMT  120
DPEPGRCRRT DGKKWRCKRD VIPGQKYCGQ HVHRGRRSRK PVEASEHVMR SDDTNIISKI  180
TKLYASGDDP GSKCAPASSK TSCLSSTSRT NQYNSIEDSS AKPRFINSGY GSEKQDTYMI  240
CKRKDITTSV RTPSFIAGDN ADSKNIDFNR ISPSKTNQKQ NCGEARKHGA LVPILGLSTK  300
SDQQHTIGSE SDEQRCRRSD GKKWRCSKTV VPCQKYCETH MHRGANRKRV ASVSVVVPPS  360
KSPSYRFCPP ENDGTRRNLN TSLSIYTIPG HQNITDDDSN SNSISDATTI TDEIPAFVSH  420
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g091540.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2179150.0Solanum lycopersicum chromosome 1 clone C01SLm0026F20, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010325825.10.0growth-regulating factor 9
TrEMBLM1AYU10.0M1AYU1_SOLTU; Uncharacterized protein
STRINGSolyc01g091540.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77981922
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.11e-27growth-regulating factor 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]