PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g090460.2.1
Common NameTHOM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 287aa    MW: 32143.1 Da    PI: 6.6263
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g090460.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-18126180256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq  +Lee F+++++++ +++  L+k+l+L  rqV vWFqNrRa+ k
  Solyc01g090460.2.1 126 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTK 180
                         788899***********************************************98 PP

2HD-ZIP_I/II126.11.5e-40126215191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEe+F+e+++L+p++K +l+++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l
  Solyc01g090460.2.1 126 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELR-AL 215
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575120No hitNo description
PfamPF046181.0E-143102IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.99E-18121183IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-17122185IPR009057Homeodomain-like
PROSITE profilePS5007116.925122182IPR001356Homeobox domain
SMARTSM003896.6E-15124186IPR001356Homeobox domain
CDDcd000867.88E-15126183No hitNo description
PfamPF000469.3E-16126180IPR001356Homeobox domain
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
SMARTSM003409.0E-27182225IPR003106Leucine zipper, homeobox-associated
PfamPF021835.2E-11182216IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSSEKEDGLG LSLSLGIMSC PQNNHKTTPS LPLNLLPFMH HHQVSSGRKD EGGERVRGGI  60
DMNEPARMII ECDDEEDEEE DQVLMVSSPN STVSSVSGKR SHDREENEGE RATSSLEDDG  120
GDAAARKKLR LSKEQAAVLE ETFKEHNTLN PKQKLALSKQ LNLRPRQVEV WFQNRRARTK  180
LKQTEVDCEY LKRCCENLTD ENRRLQKEVS ELRALKLSPQ FYMNMSPPTT LTMCPQCERV  240
AVSSSSSSSS VVNATRAQNH QAPVPMNKPW AAMFASKTLD VQRSQM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174182RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.52710.0fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g090460.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By transition from light to far-red light. {ECO:0000269|PubMed:8106086}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136130.0Lycopersicon esculentum clone 132414F, mRNA sequence
GenBankX912120.0L.esculentum mRNA for HD-ZIP protein
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234233.10.0HD-ZIP protein
SwissprotP929534e-85ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLQ424370.0Q42437_SOLLC; HD-ZIP protein
STRINGSolyc01g090460.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.14e-78homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I
    Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development.
    Plant Signal Behav, 2014.
    [PMID:23838958]
  3. Francisco M, et al.
    Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense.
    Front Plant Sci, 2016. 7: p. 1010
    [PMID:27462337]
  4. Gallemí M, et al.
    A non-DNA-binding activity for the ATHB4 transcription factor in the control of vegetation proximity.
    New Phytol., 2017. 216(3): p. 798-813
    [PMID:28805249]
  5. Meissner R,Theres K
    Isolation and characterization of the tomato homeobox gene THOM1.
    Planta, 1995. 195(4): p. 541-7
    [PMID:7766050]