PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g079480.2.1
Common NameLeZIP2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 145aa    MW: 16601.6 Da    PI: 6.5375
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g079480.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.2e-122381563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +r+++NRe+ArrsR+RK++ +eeL     +L+++ +  ++++e+   +  +l++e+
  Solyc01g079480.2.1 23 RKRKRMESNRESARRSRKRKQQHLEELMSQLTQLQNQSTIWREKIESVGRNFHTLDAEN 81
                        67899****************************************99988888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-101976No hitNo description
SMARTSM003384.0E-171983IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.0472184IPR004827Basic-leucine zipper domain
PfamPF001705.0E-92379IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.69E-112377No hitNo description
CDDcd147026.85E-152475No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MASTQQPASS GSDGQRYATN DERKRKRMES NRESARRSRK RKQQHLEELM SQLTQLQNQS  60
TIWREKIESV GRNFHTLDAE NNVLRAQMAE LTERLDSLNS LTRFWADANG LAVDIPEIPD  120
TLLEPWQLPC PIQPITASAD MFQF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12441RKRMESNRESARRSRKRK
23541RRSRKRK
33542RRSRKRKQ
43742SRKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.1300.0callus| flower| fruit| leaf| root| seed| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In developing seeds, accumulates in embryo cotyledons during late maturation, from the torpedo to the green cotyledon stages. Also present in endosperm. {ECO:0000269|PubMed:19531597}.
UniprotTISSUE SPECIFICITY: Expressed in developing seeds. {ECO:0000269|PubMed:19531597}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}.
Function -- GeneRIF ? help Back to Top
  1. LebZIP2 might play roles as an abiotic stress-signaling pathway and as a transcriptional regulator of the NbNOA1 or NbNR genes. [LeZIP2]
    [PMID: 18959814]
  2. SlbZIP1 exerts an essential role in salt and drought stress tolerance through modulating an ABA-mediated pathway, and SlbZIP1 may hold potential applications in the engineering of salt- and drought-tolerant tomato cultivars. [bZIP1]
    [PMID: 29739325]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g079480.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence
GenBankAC2459950.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-57d7 map 1, complete sequence
GenBankAF1766410.0Lycopersicon esculentum bZIP DNA-binding protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234339.11e-103bZIP transcription factor
RefseqXP_015061256.11e-103bZIP transcription factor 53-like
SwissprotQ9LZP82e-45BZP53_ARATH; bZIP transcription factor 53
TrEMBLQ9SPF71e-102Q9SPF7_SOLLC; BZIP DNA-binding protein
STRINGSolyc01g079480.2.11e-103(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28102351
Representative plantOGRP5511678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.19e-48basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Stanković B,Vian A,Henry-Vian C,Davies E
    Molecular cloning and characterization of a tomato cDNA encoding a systemically wound-inducible bZIP DNA-binding protein.
    Planta, 2000. 212(1): p. 60-6
    [PMID:11219584]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Seong ES, et al.
    LebZIP2 induced by salt and drought stress and transient overexpression by Agrobacterium.
    BMB Rep, 2008. 41(10): p. 693-8
    [PMID:18959814]
  4. Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X
    An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment.
    Front Plant Sci, 2017. 8: p. 277
    [PMID:28293251]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  6. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  7. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]
  8. Zhu M, et al.
    Basic leucine zipper transcription factor SlbZIP1 mediates salt and drought stress tolerance in tomato.
    BMC Plant Biol., 2018. 18(1): p. 83
    [PMID:29739325]