PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g079380.1.1
Common NameLOC101268315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 496aa    MW: 56201.3 Da    PI: 7.1794
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g079380.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.77.3e-921244932374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl.fsevsP 89 
                          + Ll++Ae vs+++  +a+++L++ + las++g+p+qR+++yf++AL +r+ r++ +l+ ++ +++++ ++  ++++++a  + +++  P
  Solyc01g079380.1.1 124 AQILLAVAEKVSDQHYDRARKFLSQCQLLASNTGNPVQRAVFYFAQALGERIDRETGKLMPKICTETDELNSicVASRFHASFVaLHQEVP 214
                         689***************************************************88888877766666555567444444443359999** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                         + ++ h+t  qaIle+v+ + +vH iDf i  G+QW++L+qa a+R+ ++  +++iT+++s   ++ke++ etg+ L++fA++l+ pf+f+
  Solyc01g079380.1.1 215 FTQIVHFTGIQAILESVAMKPKVHLIDFLIRTGVQWASLIQAAAERKdNPIEHMKITVIES---VNKERVIETGKSLESFANSLNFPFSFK 302
                         **********************************************955566*********...78************************* PP

                GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++   + ++l+ +++++kp+Ea++++ ++ l  +     s++++ ++ +++v++l+P ++vv+e ea++ns+ F++rf+++l yysalfd+
  Solyc01g079380.1.1 303 IIFLPDRNQLTEDHFDIKPDEAVVIHAAFFLRAMI----SIPNCLETAMRVVRRLQPSLMVVSEVEANLNSPLFVNRFIDTLFYYSALFDC 389
                         *9999*************************99998....77777777******************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvl 360
                         le  + r++++r+++E    g  i+nvv +eg+er+ r  +l  Wr+ l+++G+++v+ls++   qa+l++++++ ++  +v+ ++gs+++
  Solyc01g079380.1.1 390 LEDVMKRDDQHRMTLEVS-YGAGIRNVVGNEGEERVIRSVNLDVWRSFLKRFGMEEVKLSDTCLYQANLIIQQFAcKNSCSVDVNRGSFMI 479
                         ****************99.9*******************************************************9999************ PP

                GRAS 361 gWkdrpLvsvSaWr 374
                          Wk+ p++s+SaW+
  Solyc01g079380.1.1 480 SWKGTPIYSTSAWK 493
                         *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.56897472IPR005202Transcription factor GRAS
PfamPF035142.5E-89124493IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MNKQQEELNE HAAHSAGQLS RGKTKLNNLE TGSNVEEVPF LSLAPFELLS NNPSRCRRRD  60
KVRDVNGGAN MHQKLSATQI MRLAGERFIQ FSSNKFININ NLLHPYGSAF SDLSPEDNQN  120
VELAQILLAV AEKVSDQHYD RARKFLSQCQ LLASNTGNPV QRAVFYFAQA LGERIDRETG  180
KLMPKICTET DELNSICVAS RFHASFVALH QEVPFTQIVH FTGIQAILES VAMKPKVHLI  240
DFLIRTGVQW ASLIQAAAER KDNPIEHMKI TVIESVNKER VIETGKSLES FANSLNFPFS  300
FKIIFLPDRN QLTEDHFDIK PDEAVVIHAA FFLRAMISIP NCLETAMRVV RRLQPSLMVV  360
SEVEANLNSP LFVNRFIDTL FYYSALFDCL EDVMKRDDQH RMTLEVSYGA GIRNVVGNEG  420
EERVIRSVNL DVWRSFLKRF GMEEVKLSDT CLYQANLIIQ QFACKNSCSV DVNRGSFMIS  480
WKGTPIYSTS AWKFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-4714649326375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004229557.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLK4AXI30.0K4AXI3_SOLLC; Uncharacterized protein
STRINGSolyc01g079380.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
AsteridsOGEA139101114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.15e-59RGA-like 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]