PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g079370.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 845aa    MW: 95848 Da    PI: 5.1691
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g079370.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS291.52.3e-894728421374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn........sseelaalkl 83 
                         lv+lLl++Ae v++++++la++l++r    as +g+p+qRl  yf++AL++r+ rs+   y     + t+e++        s  + +a+ +
  Solyc01g079370.2.1 472 LVHLLLAAAEEVNNQQFHLASKLISRCMWVASDSGNPVQRLSYYFAKALEERIDRSTG-RY-----TCTDEDHhlkyikimSLGTNSAFLT 556
                         68*****************************************************322.22.....2222222011223333334444455 PP

                GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelg 173
                          +++ P+ ++ +++  q+I+e v +++++H iDf+i  G+QW+ L+qaLa++  ++   l+iT+vgs    +ke+ e+t + L++f ++lg
  Solyc01g079370.2.1 557 CHQLIPFSQVMQFAGVQTIVENVRSAKKIHLIDFNIRSGIQWIVLIQALAEKGdSPIELLKITAVGS---IEKENFEATSNTLHSFTKSLG 644
                         89*************************************************98344559********...679****************** PP

                GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                         +pf+f+++ +++++d++ e+ ++k++E++aV +   l ++l+++ +l++    ++k+v+s+ P+++vv e ea+hns+sFl+rf+e+l +y
  Solyc01g079370.2.1 645 LPFSFDIVFVSDMKDFKKESVNIKTDETVAVYCNSILRTMLSKPDCLDN----LMKVVRSIGPTIIVVGEVEANHNSPSFLNRFIETLFFY 731
                         ****************************************977777766....************************************** PP

                GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveee 354
                         sa+fd++e  + r s  r+++E +++g+ i+n+va+e ++r+ r+ +le Wr+ + ++G+ + +lse+a  qa+l+l++++ +    ++++
  Solyc01g079370.2.1 732 SAFFDCFEDCMDRCSPCRTTIEGVYFGEGIRNIVAAEAEDRFTRNVKLEVWRAFFARFGMVEEELSESAWYQAHLILKQFAqGSSCDLQKD 822
                         *********************************************************************************77779999** PP

                GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                          + l++gWk+ p+ s+S W+
  Solyc01g079370.2.1 823 GKGLIIGWKGTPIHSLSIWK 842
                         *******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.257446821IPR005202Transcription factor GRAS
PfamPF035148.0E-87472842IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MDSFANLFRE PFQFFTTILL SLLFPLSFLI ISRLSVAHYL IDLVGYSKTE ISNNCDLLIK  60
FFLQVNPIFL HVLVSIISVA ALSHTLTGGT SCFIKRTPEP VSRLRLYTAW FFVCILQICV  120
GLGIEGSIAA GVDAYEIGYE RGFLTRAIFF LGLNETMFFW SNIFVKPVVD DTVFGILQEN  180
RWIEKAALAM SFGGLWWWRL RDEVEFLVVV VEKKRDLLIS IGLADFVGWW LYYLTVTIGM  240
IKIVKTLVWL VYVMFGRRVV DFDNTDGDSR NNDEKDDQFH LKGYERSELV VNGIEEGCVD  300
IDSLYSICGH NNEENTSDEQ VRTNLLEDQQ QSLSDWTQNH FLTNTVMPLQ PVQIQSTIEA  360
PTNDDFPPQV PAPANSSNEK PKPFSLASLE LLSNYGRLSK KSSEENLCTN ALSCEAHLEN  420
SHKLPMKEIL RAAGERYIQY STQRLDGFSM FIHPYGSALS GLCMEETRDV ELVHLLLAAA  480
EEVNNQQFHL ASKLISRCMW VASDSGNPVQ RLSYYFAKAL EERIDRSTGR YTCTDEDHHL  540
KYIKIMSLGT NSAFLTCHQL IPFSQVMQFA GVQTIVENVR SAKKIHLIDF NIRSGIQWIV  600
LIQALAEKGD SPIELLKITA VGSIEKENFE ATSNTLHSFT KSLGLPFSFD IVFVSDMKDF  660
KKESVNIKTD ETVAVYCNSI LRTMLSKPDC LDNLMKVVRS IGPTIIVVGE VEANHNSPSF  720
LNRFIETLFF YSAFFDCFED CMDRCSPCRT TIEGVYFGEG IRNIVAAEAE DRFTRNVKLE  780
VWRAFFARFG MVEEELSESA WYQAHLILKQ FAQGSSCDLQ KDGKGLIIGW KGTPIHSLSI  840
WKFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-4149084221375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.230840.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010322387.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLK4AXI20.0K4AXI2_SOLLC; Uncharacterized protein
STRINGSolyc01g079370.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Representative plantOGRP2520734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-48RGA-like 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]