PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g079210.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 452aa    MW: 50698.5 Da    PI: 9.8687
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g079210.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.82.5e-08130172346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +WT+eE ++l d++k++  + +  Ia +++ +Rt +++k+r+++
  Solyc01g079210.2.1 130 SWTKEETDQLFDLCKRFDLR-FVIIADRFPSNRTIEELKDRYYS 172
                         7*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162822.6E-31103177IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007175.1E-9127176IPR001005SANT/Myb domain
SuperFamilySSF466898.58E-7127173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-6129174IPR009057Homeodomain-like
CDDcd116581.05E-18131173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043967Biological Processhistone H4 acetylation
GO:0043968Biological Processhistone H2A acetylation
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
GO:0003714Molecular Functiontranscription corepressor activity
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MDAKDILGLP KNGPLMSQEK KSRPQKESQR KPDGISREVY ALTGGIAPLM PSIDINQLKK  60
RALSESEKIT WQWLPFTSSA RKDNLQLYHW VRVVNGVPPT GDYSFAKYNK SVDVIEYTDE  120
EYEKFLSNPS WTKEETDQLF DLCKRFDLRF VIIADRFPSN RTIEELKDRY YSVSRAITIA  180
RAPSPADVAG HPLVKPYNAS QEVERKRALS MVLSQTKHQE RRDAEVLAAA KRISESRKAA  240
KAAEETELPD VSDAAPEGAE KAGIDVISTS PNAQLPSGIA APPVSETAST LASLRMLRVY  300
LRTYGLEQMV QAASSSAGLR TIKRVEQTLQ DLGVNLKPKV PTKLVCAEHL ELRKEILTLL  360
NLQKQVQYKE SEGSSYREGS YSETPGTPPK RAQRATDQDR TFIPDSTSFG GERAGKKDQK  420
RAWTIIRSTI FTSTVKTASQ VKNFRWMNWK D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A2e-21102187493DNA methyltransferase 1-associated protein 1
4iej_A2e-21102187493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.52470.0callus| flower| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g079210.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135620.0Lycopersicon esculentum clone 132299F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004229372.10.0SWR1-complex protein 4 isoform X2
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A3Q7EHC50.0A0A3Q7EHC5_SOLLC; Uncharacterized protein
STRINGSolyc01g079210.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76261515
Representative plantOGRP6713810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]