PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g065890.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 120aa    MW: 14270.6 Da    PI: 8.3175
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g065890.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix45.32.3e-1429882483
            trihelix 24 gklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfd 83
                         +  +++W++vs++++ + ++r+p+qC+ +w+nl +++ kike+e++ ++e++s + + +
  Solyc01g065890.1.1 29 VNDVEAKWDSVSSYCKIQWVNRGPIQCQRRWSNLFGDFMKIKEWESQIKEEKESFWMMCN 88
                        456689******************************************999998887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.6E-71687No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MASESNNLKQ LILILYTDFD IRNQSINGVN DVEAKWDSVS SYCKIQWVNR GPIQCQRRWS  60
NLFGDFMKIK EWESQIKEEK ESFWMMCNNF KREKNLSGFI IEKCLIFLIM EMAIKKVWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2466361e-149Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-44h3 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015167214.13e-44PREDICTED: trihelix transcription factor ASR3-like
SwissprotQ8VZ203e-31ASR3_ARATH; Trihelix transcription factor ASR3
TrEMBLK4AWJ23e-82K4AWJ2_SOLLC; Uncharacterized protein
STRINGSolyc01g065890.1.17e-82(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP17471336
AsteridsOGEA2634722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.12e-32Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]